| PDBID: | 8s7h | | Status: | HPUB -- hold until publication | | Title: | Fructose 6-phosphate aldolase (FSA) from Escherichia coli | | Authors: | Hebert, H., Widersten, M. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8s7i | | Status: | HPUB -- hold until publication | | Title: | Fructose 6-phosphate aldolase, L107C/A129G/R134V/L163C/S166G mutant | | Authors: | Hebert, H., Widersten, M. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8s7g | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Pseudomonas aeruginosa Recombinase A (RecA) in complex with LexAS125A mutant | | Authors: | De Felice, S., Vascon, F., Huber, S.T., Catalano, C., Jakobi, A.J., Cendron, L. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8s7f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Escherichia coli LpxH in complex with EBL-2805 | | Authors: | Sooriyaarachchi, S., Mowbray, S.L., Bergfors, T., Jones, T.A. | | Deposition date: | 2024-03-01 | | Sequence: | >Entity 1
MATLFIADLHLCAEEPAITAGFLRFLAGEARKADALYILGDLFEAWIGDDDPNPLHHQMAAAIKAVSDSGVPCYFIHGNRDFLLGKRFARESGMTLLPEEKVLELYGRRVLIMHGDTLCTDDAGYQAFRAKVHKPWLQTLFLALPLFVRKRIAARMRANSKEANSSKSLAIMDVNQNAVVSAMEKHQVQWLIHGHTHRPAVHELIANQQTAFRVVLGAWHTEGSMVKVTADDVELIHFPFHHHHHH
|
|
| PDBID: | 8yid | | Status: | HPUB -- hold until publication | | Title: | Imine Reductase from Burkholderia ubonensis in complex with NADH and 6-methyl-2,3,4,5-tetrahydropyridine | | Authors: | Ma, Z.F., Shen, X.Y. | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MAQTVGVIGTGLMGSALVNTLLKAGTKVTVWDGRKEATAGVVANGAKLASSFVELVNGNDVVISIVSSASIGANLFREHVSQLNLDGRYVANLSTAMPEDGEAFRDIIESNGGRFISAAISSYPDLIGGPYTAIQYAGKEEVWRAVEATFKPLAPEGTIYTGANLAVPPIVDAAMTGSFYAVSLAGFLEAAAYAKARGVSPSQLGDFADKMLDLVRYKVHKSIREIEANNFETIQATVDVYLDAVIQWRDALKDVGLRASHIAALADDLTVTRDAGYGSLGFTAQFLTASKVD
|
|
| PDBID: | 8yip | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yiq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of human proteasome assembly intermediate P-6a0b | | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yir | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of human proteasome assembly intermediate P-7a0b | | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yis | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human proteasome assembly intermediate P-7a2b | | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yit | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of human proteasome assembly intermediate P-7a3b | | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yiu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of human proteasome assembly intermediate P-7a4b | | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yiw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of human proteasome assembly intermediate P-7a6b | | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yix | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of human proteasome assembly intermediate half-proteasome | | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yiy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of human proteasome assembly intermediate preholo-1 | | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yiz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of human proteasome assembly intermediate preholo-2 | | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yj0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of human proteasome assembly intermediate P-twisted | | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yj1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of human proteasome assembly intermediate P-bent | | Authors: | Han, Y., Han, Q., Tang, Q., Lin, X., Ye, M., Wu, M., Zhang, Y., Liu, K. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yii | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yin | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in YF23694-bound state | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yiv | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yj2 | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yj3 | | Status: | HPUB -- hold until publication | | Title: | N17.1.2 recognition of NRAS neoantigens | | Authors: | Wu, D.C., Mariuzza, R.A. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yim | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yi8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yi6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
