| PDBID: | 9ht1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9ht2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htt | | Status: | HPUB -- hold until publication | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 0.19 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9htv | | Status: | HPUB -- hold until publication | | Title: | McCP in complex with photocaged nitric oxide, 1.44 s, 0.95 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9l3q | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 PT Spike Protein complex with a potent broad-spectrum macrocyclic peptide inhibitor 6L3-3P11K | | Authors: | Wang, M., Yang, J.Y., Peng, Q., Shi, Y. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9l3u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9l3v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9l42 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-12-19 | | Release date: | 2025-12-19 |
|
| PDBID: | 9l3x | | Status: | HPUB -- hold until publication | | Title: | Structure of rat TRPV1 in complex with cavidine | | Authors: | Chen, X., Yu, Y. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9l41 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mle | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Asp49 Phospholipase A2 isolated from Lachesis muta | | Authors: | Leonardo, D.A., Vargas, J.A., Pereira, H.M., Garratt, R.C. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mll | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mld | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the Portal Protein from Finegoldia magna phage Miquella | | Authors: | Harlington, A.H., Fechner, M.R., Hao, N., Shearwin, K.E., Whelan, F. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlj | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease covalently bound to compound GRL-050-23 at 1.6 A | | Authors: | Beechboard, S.N., Mesecar, A.D., Ghosh, A.K., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2024-12-19 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVT(CSO)GTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYD(CSO)VSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9mlm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mln | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlr | | Status: | HPUB -- hold until publication | | Title: | Halfwrap gamma-H2Ax containing nucleosome | | Authors: | Panigrahi, R., Edwards, R., Glover, J.N.M. | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mls | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mlv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
| PDBID: | 9mm5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-19 |
|
