| PDBID: | 8v4b | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NMR structure of a synthetic analogue of Ramoplanin A2 | | Authors: | Swarbrick, J.D., Marschall, E.A., Cryle, M.J., Tailhades, J. | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v3h | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v3t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v3w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v3u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v3x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v3y | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v3z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v41 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v3j | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v42 | | Status: | HPUB -- hold until publication | | Title: | Structure of Human Vaccinia-related Kinase 1 (VRK1) Bound to ACH000400 | | Authors: | Counago, R.M., de Souza, G.P., Azevedo, A., Guimaraes, C., Mascarello, A., Gama, F., Ferreira, M., Arruda, P. | | Deposition date: | 2023-11-28 | | Sequence: | >Entity 1
SMRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAAAAWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKAYAADPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPAANAPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRAAEIEE
|
|
| PDBID: | 8x89 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Streptococcus pneumoniae fabG | | Authors: | Xu, K.M. | | Deposition date: | 2023-11-27 | | Sequence: | >Entity 1
MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELLAEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEADFEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGFTKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTVFLAGQDYLTGQVIAIDGGLSM
|
|
| PDBID: | 8x8m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8e | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription activation complex with two PhoP molecules | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x80 | | Status: | HPUB -- hold until publication | | Title: | Structure of leptin-LepR trimer with a small gap | | Authors: | Xie, Y.F., Gao, G.F. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x85 | | Status: | HPUB -- hold until publication | | Title: | Structure of leptin-LepR dimer | | Authors: | Xie, Y.F., Shang, G.J., Qi, J.X., Gao, G.F. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x86 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8j | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8d | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription initiation complex with four GlnR and two PhoP molecules | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of lipoxygenase from Enhygromyxa salina | | Authors: | Kim, J.W., Seo, P.W., Kim, J.S. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
