| PDBID: | 9lpq | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 9lps | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-25 | | Release date: | 2026-01-25 |
|
| PDBID: | 7hzv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000000438614 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i01 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000000388593 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i02 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000000873830 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 7i07 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000001683100 | | Authors: | Asthana, P., Fraser, J.S. | | Deposition date: | 2025-01-25 |
|
| PDBID: | 9i3s | | Status: | HPUB -- hold until publication | | Title: | Photosynthetic A10B10 glyceraldehyde-3-phospahte dehydrogenase from Spinacia oleracea. | | Authors: | Marotta, R., Fermani, S., Sparla, F., Del Giudice, A. | | Deposition date: | 2025-01-24 | | Sequence: | >Entity 1
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE
>Entity 2
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQA
|
|
| PDBID: | 9i4a | | Status: | HPUB -- hold until publication | | Title: | Cobalamin-binding chimera 10 (Cob10) (crystallization condition 2) | | Authors: | Romero-Romero, S., Koch, J.-S., Hoecker, B. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i49 | | Status: | HPUB -- hold until publication | | Title: | Cobalamin-binding chimera 10 (Cob10) (crystallization condition 1) | | Authors: | Koch, J.-S., Romero-Romero, S., Hoecker, B. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3v | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4i | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3y | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN MONOACYLGLYCEROL LIPASE WITH COMPOUND 17 | | Authors: | Walter, A., Atz, K., Stenzhorn, Y., Nippa, D., Grether, U., Kuhn, B., Martin, R., Benz, J. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3u | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the AGR2 dimer in complex with the monomeric IRE1beta luminal domain | | Authors: | Yan, Y., Hardwick, S., Tung, J., Ron, D. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i44 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i42 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-2D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3w | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-8C Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i43 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-9D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3x | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-2-11B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i45 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-3-10B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 | | Sequence: | >Entity 1
QSALTQPASVSGSPGQSITISCTGTSSIFGSYYLVSWYQQYPGKAPKLIVYEGSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEAAYYCCSYAGTRTYVFGTGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADKSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
>Entity 2
EVQLVQSGSELKKPGASVKVSCKVSRSTFVNYAVNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLLISGLKADDSAVYYCAYDPLGNWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKHHHHHH
|
|
| PDBID: | 9i4c | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 17-1-12A Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4d | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 17-2-2B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4b | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 17-2-12A Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4e | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 34-1-6D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4j | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of the drug binding domain of AlbA in complex with the KMR-04-161 compound of the pyrrolobenzodiazepines class | | Authors: | Di Palma, M., Steiner, R.A. | | Deposition date: | 2025-01-24 |
|
