| PDBID: | 9epc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the Plastid-encoded RNA polymerase from Sinapis alba | | Authors: | Effantin, G., Blanvillain, R., Cobessi, D. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epj | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 41 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epe | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 10uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 9epa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epk | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 24 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8yps | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8yq2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | ratTRPV1 bount with inhibitor AMG9810 | | Authors: | Gao, Y.H., Li, Z.X. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8yq0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8yq1 | | Status: | HPUB -- hold until publication | | Title: | Linear form of FGF10 from Homo sapiens | | Authors: | Park, H.J., Park, Y.S., Lee, C.E., Kang, L.W. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8ypi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | crystal structure mutant PPART P8A | | Authors: | Yin, H.S. | | Deposition date: | 2024-03-17 | | Release date: | 2025-03-17 |
|
| PDBID: | 8yph | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-17 | | Release date: | 2025-03-17 |
|
| PDBID: | 9b2x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-17 |
|
| PDBID: | 9b2w | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-17 | | Release date: | 2025-03-17 |
|
| PDBID: | 9b2v | | Status: | HPUB -- hold until publication | | Title: | SARS CoV-2 Spike protein Ectodomain with internal tag, 1RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 9b2y | | Status: | HPUB -- hold until publication | | Title: | Kynurenine monooxygenase from Pseudomonas fluorescens complexed with 4-chlorophenylacetyltetrazole | | Authors: | Phillips, R.S., Ma, W. | | Deposition date: | 2024-03-17 | | Sequence: | >Entity 1
MTATDNARQVTIIGAGLAGTLVARLLARNGWQVNLFERRPDPRIETGARGRSINLALAERGAHALRLAGLEREVLAEAVMMRGRMVHVPGTPPNLQPYGRDDSEVIWSINRDRLNRILLDGAEAAGASIHFNLGLDSVDFARQRLTLSNVSGERLEKRFHLLIGADGCNSAVRQAMASVVDLGEHLETQPHGYKELQITPEASAQFNLEPNALHIWPHGDYMCIALPNLDRSFTVTLFLHHQSPAAQPASPSFAQLVDGHAARRFFQRQFPDLSPMLDSLEQDFEHHPTGKLATLRLTTWHVGGQAVLLGDAAHPMVPFHGQGMNCALEDAVALAEHLQSAADNASALAAFTAQRQPDALAIQAMALENYVEMSSKVASPTYLLERELGQIMAQRQPTRFIPRYSMVTFSRLPYAQAMARGQIQEQLLKFAVANHSDLTSINLDAVEHEVTRCLPPLSHLS
|
|
| PDBID: | 9ep5 | | Status: | HPUB -- hold until publication | | Title: | Alpha-Galactosaminidase from Environmental sample (99.2% identity to Myxococcus fulvus enzyme) | | Authors: | Roth, C., Moroz, O.V., Miranda, S.A.D., Jahn, L., Blagova, E., Lebedev, A.A., Segura, D.R., Stringer, M.A., Friis, E.P., Davies, G.J., Wilson, K.S. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 9ep6 | | Status: | HPUB -- hold until publication | | Title: | Alpha-Galactosaminidase family GH114 from Fusarium solani | | Authors: | Roth, C., Moroz, O.V., Miranda, S.A.D., Jahn, L., Blagova, E., Lebedev, A.A., Segura, D.R., Stringer, M.A., Friis, E.P., Davies, G.J., Wilson, K.S. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypm | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in prime-activation conformation | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypn | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric autoinhibited Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+ | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., liu, Z. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8ypo | | Status: | HPUB -- hold until publication | | Title: | Structure of dimeric Tribolium castaneum (Tc) PINK1 L552R mutant in complex with Ca2+ | | Authors: | Xu, H.Q., Liu, X.Y., Xue, J.R., Li, B.X., Yu, X.R., Qin, X.H., Mi, L.Z., Liu, Z. | | Deposition date: | 2024-03-17 |
|
