| PDBID: | 9aui | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CH848.d949.10.17.GS-DH270.UCA4 | | Authors: | Zhang, Q.E., Acharya, P. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9aup | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s74 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s76 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC JSF67 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMASMLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMLLEHHHHHH
|
|
| PDBID: | 8s7b | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-29 | | Release date: | 2025-02-28 |
|
| PDBID: | 8s77 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC JSF234 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMASMLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMLLEHHHHHH
|
|
| PDBID: | 8s7a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s79 | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s75 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC FL412 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s7e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s78 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s7d | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SKP1-FBXO22 in complex with a BACH1 BTB dimer at 3.2A resolution | | Authors: | Khoshouei, M., Goretzki, B. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8s73 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8yho | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-28 | | Release date: | 2025-02-28 |
|
| PDBID: | 8yht | | Status: | HPUB -- hold until publication | | Title: | hTLR3/minibinder 7.7 | | Authors: | Kim, H., Kim, H. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8yhc | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human cytosolic NADP(+)-dependent malic enzyme in complex with small molecules | | Authors: | Huang, S.J., Wen, W.Y. | | Deposition date: | 2024-02-28 | | Release date: | 2025-02-28 |
|
| PDBID: | 8yhx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the trimeric HerA | | Authors: | Zhen, X., Zhou, B., Xiong, X. | | Deposition date: | 2024-02-28 | | Release date: | 2025-02-28 |
|
| PDBID: | 8yi1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8yi0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8yhu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | hTLR3/minibinder 8.6 | | Authors: | Kim, H., Kim, H. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8yhz | | Status: | HOLD -- hold until a certain date | | Title: | The co-crystal structure of the Fab fragment of Ab-1080 with NaV1.7 VSDII peptide | | Authors: | Juanjuan, D., Yaning, Z., Rui, Z., Yanchao, D. | | Deposition date: | 2024-02-28 | | Release date: | 2025-02-28 |
|
| PDBID: | 8yhy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8yhq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in pyraclostrobin-bound state | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8yhb | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human cytosolic NADP(+)-dependent malic enzyme in ternary complex with NADP+ and Mn2+ | | Authors: | Huang, S.J., Wen, W.Y. | | Deposition date: | 2024-02-28 | | Release date: | 2025-02-28 |
|
| PDBID: | 8yhg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-28 |
|
