PDBID: | 8wjd | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-09-25 | Release date: | 2024-09-25 |
|
PDBID: | 8wje | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-09-25 | Release date: | 2024-09-25 |
|
PDBID: | 8win | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-25 |
|
PDBID: | 8wip | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Pseudomonas aeruginosa SuhB in its apo form. | Authors: | Yadav, V.K., Maji, S., Shukla, M., Bhattacharyya, S. | Deposition date: | 2023-09-25 |
|
PDBID: | 8wio | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-25 |
|
PDBID: | 8wj0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-25 |
|
PDBID: | 8wj1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-25 |
|
PDBID: | 8wj2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-25 |
|
PDBID: | 8wiv | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-25 |
|
PDBID: | 8wj3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-25 |
|
PDBID: | 8wjg | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-25 |
|
PDBID: | 8wj4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS bound to AMP | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | Deposition date: | 2023-09-25 |
|
PDBID: | 8wit | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of hemagglutinin from Asiatic toad influenza-like virus complexed with avian receptor analog LSTa | Authors: | Zhang, D., Xie, Y.F. | Deposition date: | 2023-09-25 |
|
PDBID: | 8wis | Status: | HPUB -- hold until publication | Title: | Structure of hemagglutinin from Asiatic toad influenza-like virus complexed with human receptor analog LSTc | Authors: | Zhang, D., Xie, Y.F. | Deposition date: | 2023-09-25 |
|
PDBID: | 8wir | Status: | HPUB -- hold until publication | Title: | Crystal Structure of E447A Acyl-CoA Dehydrogenase FadE15 mutant from Mycobacteria tuberculosis in complex with C4CoA | Authors: | Liu, X., Chen, R., Ma, M. | Deposition date: | 2023-09-25 |
|
PDBID: | 8wiw | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-25 |
|
PDBID: | 8wj9 | Status: | HPUB -- hold until publication | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS in complex with MeHis and an ATP analogue | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | Deposition date: | 2023-09-25 |
|
PDBID: | 8wja | Status: | HPUB -- hold until publication | Title: | Crystal structure of methanogenic archaeon ISO4-G1 PylRS in complex with LmBrPhe and an ATP analogue | Authors: | Tsou, J.C., Huang, K.F., Ko, T.P., Wang, Y.S. | Deposition date: | 2023-09-25 |
|
PDBID: | 8wj5 | Status: | HPUB -- hold until publication | Title: | Double-wing domain of E. coli YdcD | Authors: | Kamata, K., Tame, J.R.H. | Deposition date: | 2023-09-25 |
|
PDBID: | 8wjf | Status: | HPUB -- hold until publication | Title: | Unlocking Immunogenic Potential: Innovating a Peptide/Ferritin Fusion Tag Nano-Delivery Platform from de novo design to Significantly Enhance Antigenicity of the Rabies Virus Glycoprotein Domain III | Authors: | Fu, D., Wang, M., Guo, Y. | Deposition date: | 2023-09-25 |
|
PDBID: | 8wjb | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-25 |
|
PDBID: | 8ubt | Status: | HPUB -- hold until publication | Title: | Structure of SCF-FBXL17-BACH1BTB E3 ligase complex | Authors: | Shi, H., Cao, S. | Deposition date: | 2023-09-24 | Release date: | 2025-03-26 |
|
PDBID: | 8ubs | Status: | HPUB -- hold until publication | Title: | Crystal structure of NrdJ-1 split intein fusion | Authors: | Kofoed, C., Ye, X., Jeffrey, P.D., Muir, T.W. | Deposition date: | 2023-09-24 |
|
PDBID: | 8ubq | Status: | HPUB -- hold until publication | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and 2-benzyl-4-phenylthiazole-5-carboxylic acid | Authors: | Wang, G., Heras, B. | Deposition date: | 2023-09-24 | Sequence: | >Entity 1 AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
PDBID: | 8wie | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-24 |
|