| PDBID: | 9n7p | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7u | | Status: | HPUB -- hold until publication | | Title: | Glutarate L-2-hydroxylase Q184C mutant-5''-Mal-C2-AGCT DNA conjugate at 2.17 Angstrom resolution | | Authors: | Han, Z., Mirkin, C.A. | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7w | | Status: | HPUB -- hold until publication | | Title: | antibody 5E10 Fab | | Authors: | Rupert, P.B., Strong, R.K. | | Deposition date: | 2025-02-06 | | Sequence: | >Entity 1
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTFKLLIYYTSRLHSGVPSRFSGGGSGTDYSLTISNLEKEDIATYFCQQGNTLPRTFGGGTRLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>Entity 2
(PCA)VQLLQPGAELVRPGASVRLSCKTSGYTFTSYWINWVKQRPGQGLEWIGKIFPSDSHTNYNQKFKDKATLTVDKSSSTAYMQLISPTSEDSAVYYCTRDFDTQFYAMEYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
|
|
| PDBID: | 9n7x | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9n7h | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n7b | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n6d | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n6j | | Status: | HPUB -- hold until publication | | Title: | Room Temperature X-Ray Structure of SARS-CoV-2 Main Protease Mutant D48Y, P168 Deletion | | Authors: | Bhandari, D., Kovalevsky, A. | | Deposition date: | 2025-02-05 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEYMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9n7i | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9n7j | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8r | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | CP of RHDV VLP (VP1) | | Authors: | Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J., Caston, J.R. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8j | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | AB Spike of RHDV mutant N15 | | Authors: | Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J., Caston, J.R. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8u | | Status: | HPUB -- hold until publication | | Title: | Upregulated state of BetP with Potassium in Amphipol A8-35 | | Authors: | Urbansky, K., Fu, L., Madej, M.G., Ziegler, C. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8q | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8o | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8s | | Status: | HPUB -- hold until publication | | Title: | PhiC31 dimer on attP site | | Authors: | Spagnolo, L., Sun, Y.E., Joseph, A.P. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lt0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lsz | | Status: | HPUB -- hold until publication | | Title: | Inward-open Structure of human B0AT1 | | Authors: | Imazu, T., Miyaguchi, I., Hiraizumi, M. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lsx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lt3 | | Status: | HPUB -- hold until publication | | Title: | Integrin alpha-v beta-3 in complex with Trimucrin | | Authors: | Wang, Y.T., Chuang, W.J. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lsy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lt1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
