| PDBID: | 9eta | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 3 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNVHHHHHH
>Entity 2
GPGSMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
|
|
| PDBID: | 9et3 | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 10 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9et1 | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 12 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GPGSMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
>Entity 2
GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNVHHHHHH
|
|
| PDBID: | 9et0 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | CDK2-cyclin A in complex with FragLite 13 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9etd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with ursodeoxycholic acid | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
| PDBID: | 9ett | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9et9 | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 4 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNVHHHHHH
>Entity 2
GPGSMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
|
|
| PDBID: | 9et8 | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 5 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNVHHHHHH
>Entity 2
GPGSMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
|
|
| PDBID: | 9et7 | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 6 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GPGSMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
>Entity 2
GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNVHHHHHH
|
|
| PDBID: | 9ess | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 22 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9esr | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | CDK2-cyclin A in complex with FragLite 23 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9eso | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 27 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 9etc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with chenodeoxycholic acid | | Authors: | Tassone, G., Pozzi, C. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
| PDBID: | 9eth | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8yu1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-26 | | Release date: | 2025-03-26 |
|
| PDBID: | 8ytl | | Status: | HPUB -- hold until publication | | Title: | Human PPAR alpha ligand binding domain in complex with a 1H-pyrazolo[3,4-b]pyridine-derived compound | | Authors: | Tachibana, K., Morie, T., Fukuda, S., Yuzuriha, T., Ishimoto, K., Nunomura, K., Lin, B., Miyachi, H., Oki, H., Kawahara, K., Meguro, K., Nakagawa, S., Tsujikawa, K., Akai, S., Doi, T., Yoshida, T. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ytu | | Status: | HPUB -- hold until publication | | Title: | Mipa-PETase from Micromonospora pattaloongensis | | Authors: | Hong, H., Seo, H., Park, J., Kim, K.-J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ytv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ytw | | Status: | HPUB -- hold until publication | | Title: | Kubu-PETase from Kutzneria buriramensis | | Authors: | Park, J., Seo, H., Hong, H., Kim, K.-J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ytz | | Status: | HPUB -- hold until publication | | Title: | The P185V variant of Kubu-PETase from Kutzneria buriramensis | | Authors: | Park, J., Seo, H., Hong, H., Kim, K.-J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8yty | | Status: | HPUB -- hold until publication | | Title: | The M12+P185V variant of Kubu-PETase from Kutzneria buriramensis | | Authors: | Park, J., Seo, H., Hong, H., Kim, K.-J. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8yu4 | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8yu3 | | Status: | PROC -- to be processed | | Title: | NMR solution structure of the 2:1 complex of a platinum(II) compound bound to Myc1234 G-quadruplex | | Authors: | Liu, W., Mao, Z.W. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ytk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human prolyl-tRNA synthetase in complex with inhibitor | | Authors: | Luo, Z., Zhou, H. | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8ytt | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-26 |
|
