| PDBID: | 9bzd | | Status: | HPUB -- hold until publication | | Title: | Class 23 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzg | | Status: | HPUB -- hold until publication | | Title: | Targeting N-Myc in Neuroblastoma with Selective Aurora Kinase A Degraders | | Authors: | Baker, Z.D., Tang, J., Shi, K., Aihara, H., Levinson, N.M., Harki, D.A. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bze | | Status: | HPUB -- hold until publication | | Title: | Class 26 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzh | | Status: | HPUB -- hold until publication | | Title: | Class 29 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzl | | Status: | HPUB -- hold until publication | | Title: | Targeting N-Myc in Neuroblastoma with Selective Aurora Kinase A Degraders | | Authors: | Baker, Z.D., Tang, J., Shi, K., Aihara, H., Levinson, N.M., Harki, D.A. | | Deposition date: | 2024-05-24 | | Sequence: | >Entity 1
GAMESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRT(TPO)LAGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNSQNKESASKQS
|
|
| PDBID: | 9bzk | | Status: | HPUB -- hold until publication | | Title: | Class 43 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzm | | Status: | HPUB -- hold until publication | | Title: | Class 45 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bzo | | Status: | HPUB -- hold until publication | | Title: | Class 50 model for combined refinement of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9c09 | | Status: | HPUB -- hold until publication | | Title: | Structure of K2P13.1 (THIK1) S136P in lipid nanodisc | | Authors: | Roy-Chowdhury, S., Adberemane-Ali, F., Minor, D.L. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9c0a | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Effect of glutathione on the stability, dynamics and catalysis of two different classes of glutathione transferases from Taenia solium | | Authors: | Miranda-Blancas, R., Sanchez-Juarez, C., Sanchez-Perez, L., Zubillaga, R., Flores-Lopez, R., Landa, A., Miranda-Blancas, R., Garcia-Gutierrez, P., Rudino-Pinera, E. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9c08 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Sialyl transferase from Pasturella Multocida | | Authors: | Subramanian, R., Dhanabalan, K. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9fgm | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9fgn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Coxsackievirus A9 bound with compound 18 (CL304) | | Authors: | Plavec, Z., Butcher, S.J., Mitchell, C., Buckner, C. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9fgk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9fgj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9fgl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9fgq | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Structure of human APC3loop 375-381 bound to the NCP | | Authors: | Young, R.V.C., Muhammad, R., Alfieri, C. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9fgo | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of Enterovirus 71 2A protease mutant C110A containing VP1-2A junction in the active site | | Authors: | Ni, X., Koekemoer, L., Williams, E.P., Wang, S., Wright, N.D., Godoy, A.S., Aschenbrenner, J.C., Balcomb, B.H., Lithgo, R.M., Marples, P.G., Fairhead, M., Thompson, W., Kirkegaard, K., Fearon, D., Walsh, M.A., von Delft, F. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9fgi | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-24 | | Release date: | 2025-05-24 |
|
| PDBID: | 8zmx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-24 |
|
| PDBID: | 8zmy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | F0502B-bound WT polymorph 5a alpha-synuclein fibril | | Authors: | Liu, K.E., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 8zmz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-24 |
|
| PDBID: | 8zmv | | Status: | PROC -- to be processed | | Title: | Structure of a triple-helix region of human Collagen type XVII from Trautec | | Authors: | Chu, Y., Zhai, Y., Fan, X., Fu, S., Li, J., Wu, X., Cai, H., Wang, X., Li, D., Feng, P., Cao, K., Qian, S. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 8zmw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of a triple-helix region of human Collagen type VII from Trautec | | Authors: | Chu, Y., Zhai, Y., Fan, X., Fu, S., Li, J., Wu, X., Cai, H., Wang, X., Li, D., Feng, P., Cao, K., Qian, S. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9byb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-23 |
|
