PDBID: | 8rgv | Status: | HPUB -- hold until publication | Title: | Myo-inositol-1-phosphate synthase from Thermochaetoides thermophila in complex with NAD | Authors: | Traeger, T.K., Kyrilis, F.L., Hamdi, F., Kastritis, P.L. | Deposition date: | 2023-12-14 |
|
PDBID: | 8rgm | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of nucleosome containing Widom603 DNA | Authors: | Motorin, N.A., Afonin, D., Armeev, G.A., Moiseenko, A., Zhao, L., Vasiliev, V., Oleinikov, P., Shaytan, A., Shi, X., Studitsky, V., Sokolova, O. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vco | Status: | HPUB -- hold until publication | Title: | Crystal structure of rMcL-1 in complex with N-acetyl-D-galactosamine | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8vcp | Status: | HPUB -- hold until publication | Title: | Crystal structure of dimeric rMcL-1 in complex with raffinose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8vcs | Status: | HPUB -- hold until publication | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8vcq | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the oligomeric rMcL-1 in complex with raffinose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcu | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of the oligomeric rMcL-1 in complex with lactulose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vck | Status: | HPUB -- hold until publication | Title: | Galactose-binding lectin from Mytilus californianus, Isoform 1 (rMcL-1) | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8vcf | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcl | Status: | HPUB -- hold until publication | Title: | Crystal structure of HLA-A*03:01 in complex with a mutant PIK3CA peptide | Authors: | Ma, J., Baker, B.M. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcv | Status: | HPUB -- hold until publication | Title: | Lineage IV Lassa virus glycoprotein (Josiah) in complex with rabbit polyclonal antibody (GPC-C epitope) | Authors: | Brouwer, P.J.M., Perrett, H.R., Ward, A.B. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vd6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcg | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcm | Status: | HPUB -- hold until publication | Title: | Crystal structure of rMcL-1 in complex with galactose | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8xfu | Status: | HPUB -- hold until publication | Title: | DUF3055 from Staphylococcus aureus adopts unique strategy for structural distinctiveness | Authors: | Kim, H.J. | Deposition date: | 2023-12-14 |
|
PDBID: | 8xg0 | Status: | AUTH -- processed, waiting for author review and approval | Title: | protein-DNA complex | Authors: | Li, Z. | Deposition date: | 2023-12-14 |
|
PDBID: | 8xg3 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of monomeric WDR11-FAM91A1 complex | Authors: | Jia, G.W., Deng, Q.H., Su, Z.M., Jia, D. | Deposition date: | 2023-12-14 |
|
PDBID: | 8xfc | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the ATP-bound Mtb DppABCD with the D445A mutation of DppA | Authors: | Hu, T., Zhang, B., Rao, Z. | Deposition date: | 2023-12-13 |
|
PDBID: | 8xfi | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-13 |
|
PDBID: | 8rfz | Status: | HPUB -- hold until publication | Title: | Structure of E166A BlaC from Mycobacterium tuberculosis at pH 4.5 | Authors: | Sun, J., Bruenle, S., Ubbink, M. | Deposition date: | 2023-12-13 |
|
PDBID: | 8rg2 | Status: | HPUB -- hold until publication | Title: | Structure of BlaC from Mycobacterium tuberculosis at pH 8 | Authors: | Sun, J., Bruenle, S., Ubbink, M. | Deposition date: | 2023-12-13 |
|
PDBID: | 8rg4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-13 |
|
PDBID: | 8rg3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-13 |
|
PDBID: | 8rg7 | Status: | HPUB -- hold until publication | Title: | BmrA E504-R6G-25uMATP-Mg | Authors: | Gobet, A., Zarkadas, E., Schoehn, G., Falson, P., Chaptal, V. | Deposition date: | 2023-12-13 |
|
PDBID: | 8rga | Status: | HPUB -- hold until publication | Title: | BmrA E504-25uMATPMg | Authors: | Gobet, A., Zarkadas, E., Schoehn, G., Falson, P., Chaptal, V. | Deposition date: | 2023-12-13 |
|