| PDBID: | 8rqz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8rrh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8rr0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8rr3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8rr6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8rri | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8rr4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vrt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vrl | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium smegmatis 50S ribosomal subunit bound to HflX and chloramphenicol:50S-HflX-A-Clm | | Authors: | Majumdar, S., Koripella, R.K., Sharma, M.R., Manjari, S.R., Banavali, N.K., Agrawal, R.K. | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vry | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vrz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vrp | | Status: | HPUB -- hold until publication | | Title: | HIV-CA Disulfide linked Hexamer bound to 4-Quinazolinone Scaffold inhibitor | | Authors: | Goldstone, D.C., Walsham, L. | | Deposition date: | 2024-01-22 | | Sequence: | >Entity 1
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKAR
|
|
| PDBID: | 8vro | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8vrq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-22 |
|
| PDBID: | 8xzc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human cytosolic beta-alanyl lysine dipeptidase (PM20D2) Tyr314Phe mutant | | Authors: | Chandravanshi, K., Kumar, A., Makde, R.D. | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzu | | Status: | HPUB -- hold until publication | | Title: | HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) bound with 4-hydroxy benzoic acid - Conformation II at 2.33 angstrom resolution | | Authors: | Manjunath, K., Goswami, A. | | Deposition date: | 2024-01-21 | | Sequence: | >Entity 1
MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKATLAEMLARMENRGLVRREHDAADKRRRFVWLTAEGEKVLAAAIPIGDSVDEEFLGRLSAEEQELFMQLVRKMMNTLEHHHHHH
|
|
| PDBID: | 8xzz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xze | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8y01 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Medium-wave-sensitive opsin 1 | | Authors: | Peng, Q., Jiang, H.H., Cheng, X.Y., Li, J., Zhang, J. | | Deposition date: | 2024-01-21 | | Release date: | 2025-01-21 |
|
| PDBID: | 8y02 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Short-wave-sensitive opsin 1 | | Authors: | Peng, Q., Jiang, H.H., Cheng, X.Y., Li, J., Zhang, J. | | Deposition date: | 2024-01-21 | | Release date: | 2025-01-21 |
|
| PDBID: | 8xz8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BA.2.86 Spike in complex with bovine ACE2 (bound 1 ACE2) | | Authors: | Yue, C., Liu, P. | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 8xzo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
