| PDBID: | 8x49 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (100 nM Ca2+) | | Authors: | Chen, Q., Hu, H. | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x4c | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (20 uM Ca2+, 2 mM ATP) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x45 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x4p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x5h | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8x5g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8fxw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-01-25 | | Release date: | 2024-12-31 |
|
| PDBID: | 8x5o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the post-fusion core of MjHKUr-CoV spike protein. | | Authors: | Yun, Z., Xia, Y., Fei, S. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8x5p | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MjHKUr-CoV spike HR1 in complex with EK1 peptide | | Authors: | Yun, Z., Xia, Y., Fei, S. | | Deposition date: | 2023-11-17 |
|
| PDBID: | 8x6y | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8cm0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-02-17 | | Release date: | 2024-08-17 |
|
| PDBID: | 8x9i | | Status: | HPUB -- hold until publication | | Title: | Solution structure of free PDL1 promoter G-quadruplex | | Authors: | Liu, Y.S., Wang, K.B. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8x9n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8x9p | | Status: | HPUB -- hold until publication | | Title: | HURP (428-534)-alpha-tubulin-beta-tubulin complex | | Authors: | Chen, P.-P., Hsia, K.-C. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8gjq | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST in complex with T16 and SNAG peptide | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-03-16 | | Release date: | 2024-09-16 |
|
| PDBID: | 8x5t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-19 |
|
| PDBID: | 8gmg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-25 | | Release date: | 2024-10-31 |
|
| PDBID: | 8x5u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-19 |
|
| PDBID: | 8x67 | | Status: | HPUB -- hold until publication | | Title: | solution structure of Pru p 7 | | Authors: | Zheng, J., Aizawa, T., Kumeta, H. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP
|
|
| PDBID: | 8x60 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8x66 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of triple mutant X11P(P71T+N13F+Q34L) xylanase from a metagenome derived gene from sugarcane bagasse collection site | | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MAQQCITSSQTGFHGGYFYSFWTDGGGSVSFCLLNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
| PDBID: | 8x6l | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8x6x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8x6w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8x6t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Peroxiredoxin I in complex with Lithospermic Acid | | Authors: | Zhang, H., Luo, C. | | Deposition date: | 2023-11-22 |
|
