| PDBID: | 8vv8 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of EHMT2 bound to EZM8266 | | Authors: | Cocozaki, A., Farrow, N.A. | | Deposition date: | 2024-01-30 |
|
| PDBID: | 8vv1 | | Status: | HPUB -- hold until publication | | Title: | Estrogen receptor alpha ligand binding domain in complex with palazestrant | | Authors: | Ng, R.A., Barratt, S., Parisian, A., Palanisamy, G., Sun, R., Robello, B., Pena, G., Sapugay, J., Yeghikyan, D., Duncan, A., Andersen, S.E., Chawla, R., Rich, B., Hearn, B., Harmon, C., Hodges-Gallagher, L., Kushner, P.J., Greene, G.L., Myles, D.C., Fanning, S.W. | | Deposition date: | 2024-01-30 |
|
| PDBID: | 9brk | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL098-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 8gmj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-26 | | Release date: | 2024-10-31 |
|
| PDBID: | 8vvc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-30 |
|
| PDBID: | 8vvh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8vvf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-31 |
|
| PDBID: | 9brl | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL080-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 8vve | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-31 |
|
| PDBID: | 9brm | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL077-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 8vvg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-31 |
|
| PDBID: | 9brn | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL050-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9bro | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human G Protein-Coupled Receptor Kinase 5 in Complex with GRL030-22 | | Authors: | Chen, Y., Tesmer, J.J.G. | | Deposition date: | 2024-05-11 |
|
| PDBID: | 9bs0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-12 |
|
| PDBID: | 8ixo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-01 | | Release date: | 2024-10-01 |
|
| PDBID: | 8vvm | | Status: | HPUB -- hold until publication | | Title: | Structure of FabS1CE1-EPR1-1 in complex with the erythropoietin receptor | | Authors: | Singer, A.U., Bruce, H.A., Pavlenco, A., Ploder, L., Luu, G., Blazer, L., Adams, J.J., Sidhu, S.S. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 9bu5 | | Status: | HPUB -- hold until publication | | Title: | CC ProXp-ala apo solution structure | | Authors: | Duran, A.D., Foster, M.P. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8vvo | | Status: | HPUB -- hold until publication | | Title: | Structure of FabS1CE2-EPR1-1 in complex with the erythropoietin receptor | | Authors: | Singer, A.U., Bruce, H.A., Pavlenco, A., Ploder, L., Luu, G., Blazer, L., Adams, J.J., Sidhu, S.S. | | Deposition date: | 2024-01-31 | | Sequence: | >Entity 1
EVQLVESGGGLVQPGGSLRLSCAASGFNLRSYYMHWVRQAPGKGLEWVASISPYYSYTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARHGYGAMDYWGQGTLVTVFNQIQGPSVFPLAPSSKSTSGGTAALGCLVKDYFPGPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT
>Entity 2
DIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSYSLITFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVSWYVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTQGTTSVTKSFNRGEC
>Entity 3
APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPHHHHHH
|
|
| PDBID: | 8vvw | | Status: | HPUB -- hold until publication | | Title: | Structure of the five-fold capsomer of the Drosophila retrotransposon Copia capsid | | Authors: | Liu, Y., Kelch, B.A. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 9bl0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8vvk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-31 |
|
| PDBID: | 9bl8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8vvl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8w1g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
| PDBID: | 9bkv | | Status: | HPUB -- hold until publication | | Title: | DosP R97A bent form | | Authors: | Kumar, P., Kober, D.L. | | Deposition date: | 2024-04-29 |
|
