| PDBID: | 8w14 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
| PDBID: | 9eph | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 53 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-16 |
|
| PDBID: | 9epi | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 53 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w1j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-16 |
|
| PDBID: | 8w1k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-16 |
|
| PDBID: | 8w1p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-16 |
|
| PDBID: | 9ep8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ROCK2 in complex with a 8-(azaindolyl)-benzoazepinone inhibitor | | Authors: | Pala, D., Clark, D., Pioselli, B., Accetta, A., Rancati, F. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
| PDBID: | 8w1q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-17 |
|
| PDBID: | 9epj | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 41 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epe | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 10uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 8w1u | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Main protease bound to non-covalent lead molecule NZ-804 | | Authors: | Bian, X., Tang, S., Sacchettini, J.C. | | Deposition date: | 2024-02-18 |
|
| PDBID: | 9epn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8w23 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human tankyrase 2 SAM-PARP filament bound to compound, TDI-2804 (consensus map). | | Authors: | Malone, B.F., Zimmerman, J.L., Dow, L.E., Hite, R.K. | | Deposition date: | 2024-02-19 |
|
| PDBID: | 9epq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8w1w | | Status: | HPUB -- hold until publication | | Title: | 2.03 angstrom resolution crystal structure of as-isolated KatG from Mycobacterium tuberculosis with an MYW-OOH cofactor | | Authors: | Liu, A., Li, J. | | Deposition date: | 2024-02-19 |
|
| PDBID: | 8w24 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-19 |
|
| PDBID: | 9eps | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9epo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8w1y | | Status: | HPUB -- hold until publication | | Title: | 2.30 angstrom resolution intermediate crystal structure of KatG from Mycobacterium tuberculosis with an MYW-OOH cofactor soaked with peroxide for 1 minute | | Authors: | Li, J., Duan, R., Liu, A. | | Deposition date: | 2024-02-19 |
|
| PDBID: | 8w1x | | Status: | HPUB -- hold until publication | | Title: | 2.35-angstrom resolution intermediate crystal structure of KatG from Mycobacterium tuberculosis with an MYW-OOH cofactor soaked with peroxide for 5 minutes | | Authors: | Liu, A., Li, J. | | Deposition date: | 2024-02-19 |
|
| PDBID: | 9eq2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-20 |
|
| PDBID: | 8w2e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-20 |
|
| PDBID: | 8w2f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-20 |
|
| PDBID: | 9ept | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Plastid Redox Insensitive 2 from Arabidopsis thaliana | | Authors: | Ruedas, R., Vallet, A., Blanvillain, R., Cobessi, D. | | Deposition date: | 2024-03-20 |
|
