| PDBID: | 9epe | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 10uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 8w33 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8frq | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST in complex with T14, long soaking | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-01-08 | | Release date: | 2024-07-08 |
|
| PDBID: | 9epa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w2y | | Status: | HPUB -- hold until publication | | Title: | Structure and interactions of HIV-1 gp41 CHR-NHR reverse hairpin constructs reveal molecular determinants of antiviral activity | | Authors: | McAndrew, R.P., Ralston, C.Y., Gochin, M. | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8w32 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9epk | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 24 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8frv | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST in complex with T17, short soaking | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-01-09 | | Release date: | 2024-07-09 |
|
| PDBID: | 8w2u | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human tankyrase 2 SAM-PARP filament -apo state (consensus map). | | Authors: | Malone, B.F., Zimmerman, J.L., Dow, L.E., Hite, R.K. | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9eps | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8fse | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain | | Authors: | Wu, J., Gao, T. | | Deposition date: | 2023-01-09 | | Release date: | 2024-06-30 |
|
| PDBID: | 9epo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8w2t | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human tankyrase 2 SAM-PARP filament - apo state (focused refinement map). | | Authors: | Malone, B.F., Zimmerman, J.L., Dow, L.E., Hite, R.K. | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8w2s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8w2v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9epu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the human CDKL5 kinase domain with compound CAF-382 | | Authors: | Richardson, W., Chen, X., Newman, J.A., Bakshi, S., Lakshminarayana, B., Brooke, L., Bullock, A.N. | | Deposition date: | 2024-03-20 |
|
| PDBID: | 8w2q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9eqa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 9eq9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8w30 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9eq8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8w2x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8w2z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9eqb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-21 |
|
| PDBID: | 8w35 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
