| PDBID: | 8vwg | | Status: | HPUB -- hold until publication | | Title: | Structure of the Drosophila retrotransposon Copia capsid | | Authors: | Liu, Y., Kelch, B.A. | | Deposition date: | 2024-02-01 |
|
| PDBID: | 9eom | | Status: | HPUB -- hold until publication | | Title: | 250A Vipp1 dL10Ala helical tubes in the presence of EPL | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8w06 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the reconstruction of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by maximum likelihood with PGH | | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra-Borrego, Y., Fernandez-Velasco, D.A. | | Deposition date: | 2024-02-13 |
|
| PDBID: | 9eon | | Status: | HPUB -- hold until publication | | Title: | 270A Vipp1 dL10Ala helical tubes in the presence of EPL | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8w0f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 9eot | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8w0g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 9eoo | | Status: | HPUB -- hold until publication | | Title: | 260A Vipp1 dL10Ala helical tubes in the presence of EPL | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8w0i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 9eop | | Status: | HPUB -- hold until publication | | Title: | 270A Vipp1 dL10Ala helical tubes in the presence of EPL | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8w0p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 9eov | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8w08 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the worst case reconstruction of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by maximum likelihood | | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra-Borrego, Y., Fernandez-Velasco, D.A. | | Deposition date: | 2024-02-13 |
|
| PDBID: | 8w0n | | Status: | HPUB -- hold until publication | | Title: | IRED crystal structure | | Authors: | Peat, T.S., Newman, J. | | Deposition date: | 2024-02-13 |
|
| PDBID: | 9ep0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 8w0o | | Status: | HPUB -- hold until publication | | Title: | GDH-105 crystal structure | | Authors: | Peat, T.S., Newman, J. | | Deposition date: | 2024-02-13 |
|
| PDBID: | 9ep2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the complex of human carbonic anhydrase I with 4-sulfamoylphenyl 3-(p-tolylthio)propanoate | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2024-03-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8w11 | | Status: | HPUB -- hold until publication | | Title: | Structure of human PIN1 covalently derivatized with SuFEx compound | | Authors: | Louie, G.V., Noel, J.P., Wang, W.-M., Kelly, J.W. | | Deposition date: | 2024-02-14 |
|
| PDBID: | 9ep7 | | Status: | HPUB -- hold until publication | | Title: | Poecitoxin-1a from Poecilotheria subfusca spider, a new potent peptide blocker of the human Cav1.2 channel subtype | | Authors: | Kurz, M., Kurz, M. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8vx4 | | Status: | HPUB -- hold until publication | | Title: | Human OGG1 bound to a 35-bp DNA with an 8-oxoG in the middle | | Authors: | You, Q., Li, H. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8w1g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
| PDBID: | 9epd | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 8 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9ep9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w13 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
| PDBID: | 8w14 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
