| PDBID: | 9hkr | | Status: | HPUB -- hold until publication | | Title: | NMR structure of the C-terminal domain of the human SPAG1 protein | | Authors: | Chagot, M.E., Quinternet, M. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hle | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis SteB (Rv1698), a cell division regulator | | Authors: | Carloni, G., Wehenkel, A.M., Alzari, P.M. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hl9 | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME WITH P/E-site tRNA AND mRNA : LM14Cs1H3 sKO STRAIN | | Authors: | Rajan, K.S., Yonath, A. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hku | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CREBBP histone acetyltransferase domain in complex with Acetyl-Coenzyme A | | Authors: | Mechaly, A.E., Zhang, W., Cui, G., Green, M.R., Rodrigues-Lima, F. | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hks | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hl0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hl7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hl2 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-12-04 | | Release date: | 2025-12-04 |
|
| PDBID: | 9hli | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hlh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hl6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hl8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hla | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hlb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9hlc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-04 |
|
| PDBID: | 9ku3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9kty | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the TIA-1 prion-like domain amyloid fibril, WT | | Authors: | Inaoka, D., Miyata, T., Makino, F., Ohtani, Y., Ekari, M., Kobayashi, R., Imamura, K., Sakamoto, E., Kodama, S.T., Yoshida, N., Kato, T., Namba, K., Tochio, H., Sekiyama, N. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ktz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the TIA-1 prion-like domain amyloid fibril, G355R | | Authors: | Inaoka, D., Miyata, T., Makino, F., Ohtani, Y., Ekari, M., Kobayashi, R., Imamura, K., Sakamoto, E., Kodama, S.T., Yoshida, N., Kato, T., Namba, K., Tochio, H., Sekiyama, N. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku7 | | Status: | HPUB -- hold until publication | | Title: | complex structure of methyltransferases SMYD2 and inhibitor (17) | | Authors: | Sun, Y.L., Lu, J., Zhao, K.H., Lu, W.C. | | Deposition date: | 2024-12-03 | | Sequence: | >Entity 1
GRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
|
|
| PDBID: | 9ku8 | | Status: | HPUB -- hold until publication | | Title: | Solution NMR structure of P1 peptide bound with E. coli LPS | | Authors: | Mohid, S.A., Bhunia, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ku0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9kug | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9ktu | | Status: | HPUB -- hold until publication | | Title: | Structure of TauT in complex with beta-alanine | | Authors: | Yin, Y.X., Lu, Y.S., Ding, D. | | Deposition date: | 2024-12-03 |
|
