| PDBID: | 9n0p | | Status: | HPUB -- hold until publication | | Title: | Open tetramer | | Authors: | Gupta, J., Izard, T. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0w | | Status: | HPUB -- hold until publication | | Title: | HTLV-1 Gag capsid from immature particles | | Authors: | Arndt, W.G., Ramezani, A., Chen, B., Perilla, J.R., Zhang, W., Mansky, L.M. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0y | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0z | | Status: | HPUB -- hold until publication | | Title: | PP2A-B55 Holoenzyme with B55i | | Authors: | Shi, S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0g | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0h | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0e | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of GCGR-Gs complex with oxyntomodulin | | Authors: | Zhang, X., Jiang, Y., Belousoff, M.J., Wootten, D., Sexton, P.M. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n11 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0d | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0q | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0r | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n1a | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n10 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3s | | Status: | HPUB -- hold until publication | | Title: | Photosynthetic A10B10 glyceraldehyde-3-phospahte dehydrogenase from Spinacia oleracea. | | Authors: | Marotta, R., Fermani, S., Sparla, F., Del Giudice, A. | | Deposition date: | 2025-01-24 | | Sequence: | >Entity 1
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVKIIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELGIVKGTMTTTHSYTGDQRLLDASHRDLRRARAAALNIVPTSTGAAKAVSLVLPQLKGKLNGIALRVPTPNVSVVDLVVNIEKVGVTAEDVNNAFRKAAAGPLKGVLDVCDIPLVSVDFRCSDFSSTIDSSLTMVMGGDMVKVVAWYDNEWGYSQRVVDLADLVANKWPGLEGSVASGDPLEDFCKDNPADEECKLYE
>Entity 2
KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKGDIPTYVVGVNEEGYTHADTIISNASCTTNCLAPFVKVLDQKFGIIKGTMTTTHSYTGDQRLLDASHRDLRRARAACLNIVPTSTGAAKAVALVLPNLKGKLNGIALRVPTPNVSVVDLVVQVSKKTFAEEVNAAFRESADNELKGILSVCDEPLVSIDFRCTDVSSTIDSSLTMVMGDDMVKVIAWYDNEWGYSQRVVDLADIVANKWQA
|
|
| PDBID: | 9i4a | | Status: | HPUB -- hold until publication | | Title: | Cobalamin-binding chimera 10 (Cob10) (crystallization condition 2) | | Authors: | Romero-Romero, S., Koch, J.-S., Hoecker, B. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i49 | | Status: | HPUB -- hold until publication | | Title: | Cobalamin-binding chimera 10 (Cob10) (crystallization condition 1) | | Authors: | Koch, J.-S., Romero-Romero, S., Hoecker, B. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4i | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3y | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN MONOACYLGLYCEROL LIPASE WITH COMPOUND 17 | | Authors: | Walter, A., Atz, K., Stenzhorn, Y., Nippa, D., Grether, U., Kuhn, B., Martin, R., Benz, J. | | Deposition date: | 2025-01-24 |
|
