| PDBID: | 9n9b | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of SARS-CoV-2 main protease V186F covalently bound to inhibitor GRL-051-22 at 1.60 A | | Authors: | Beechboard, S.N., Meadows, M.S., Ghosh, A.K., Mesecar, A.D., Center for Structural Biology of Infectious Diseases (CSBID) | | Deposition date: | 2025-02-10 | | Sequence: | >Entity 1
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFFDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ
|
|
| PDBID: | 9n9c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n95 | | Status: | HPUB -- hold until publication | | Title: | Human TMEM63A mutant V53M closed state | | Authors: | Zheng, W., Fu, T.M., Holt, J.R. | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n8w | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9n9j | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-02-10 |
|
| PDBID: | 9luo | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9lum | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9lup | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9lur | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9lul | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9luq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9lun | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9n8r | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9n8q | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9n8n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9n8o | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9n8s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9n8t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9n8u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9n8v | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9iaa | | Status: | HPUB -- hold until publication | | Title: | DtpB in complex with photocaged nitric oxide, 1.24 s, 0.81 microjoule, SSX | | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | | Deposition date: | 2025-02-09 |
|
| PDBID: | 9lue | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the Nipah G head domain in complex with three Fabs | | Authors: | Wang, Y., Deng, Z., Zhao, H. | | Deposition date: | 2025-02-08 |
|
| PDBID: | 9lud | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 9-mer peptide from H5N1 avian influenza virus in complex with B4 DUCK MHC I (UAA*76) | | Authors: | Gao, F., Li, Y.L., Dai, M.M., Liao, M. | | Deposition date: | 2025-02-08 | | Release date: | 2026-02-08 |
|
| PDBID: | 9luk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-08 |
|
| PDBID: | 9lui | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | structure of PSP2 | | Authors: | Qi, C., Gu, T.N., Li, X.M. | | Deposition date: | 2025-02-08 |
|
