| PDBID: | 9lkh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkj | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the receptor of PL45-Olfr110-Gs complex | | Authors: | Rong, N.K., Zhang, M.H., Yang, F., Sun, J.P. | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkg | | Status: | HPUB -- hold until publication | | Title: | Ornithine decarboxylase from Lacticaseibacillus rhamnosus | | Authors: | Kim, D.S., Park, J.H., Adiko, N.N., Seo, H.T. | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lka | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of L-threonine aldolase N18S/Q39R/Y319L triple mutant in complex with glycine from Neptunomonas marina | | Authors: | Wu, J.Y., Liu, T.H., Yan, W.P., Feng, Y. | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lk5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lki | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lk4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lks | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-16 | | Release date: | 2026-01-16 |
|
| PDBID: | 9lk6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lke | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lk8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lk7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lk9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkf | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lko | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lku | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkp | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Enterobacter cloaca transaldolase | | Authors: | Kamitori, S. | | Deposition date: | 2025-01-16 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHSMELYLDTSDVAAVKKLARIFPLAGVTTNPSIVAAGKTPLDELLPALHDALGGKGRLFAQVMATTAEGMVEDARKLRAIINDLVVKVPVTVEGLAAIKMLKAEGIPTLGTAVYGAAQGMLSALAGAEYVAPYVNRVDAQGGDGIQTVIELQQLLTLHAPQSKVLAASFKTPRQALDCLLAGCESITLPLDVAQQFITSPAVDAAIVKFEQDWQGAFGRTSI
|
|
| PDBID: | 9lkn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
| PDBID: | 9lkq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-16 |
|
