| PDBID: | 7hc9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PanDDA analysis group deposition -- Crystal structure of SARS-CoV-2 NSP3 macrodmain in complex with AVI-3762 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IgG1 FC M252H at pH 7.5 | | Authors: | Reddem, E.R., Shapiro, L. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cya | | Status: | HPUB -- hold until publication | | Title: | C387S variant of D-ornithine/D-lysine decarboxylase complexed with HEPES and putrescine | | Authors: | Phillips, R.S., Blankenship, S. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
MTDSIMQNYNQLREQVINGDRRFQHKDGHLCFEGVDLDALARQYPTPFYVFSEPEIIRNIHEIQQAFAAHKNTKTFFAS(LLP)TCSVMGVLKAIRDAGICAEANSQYEVRKCLEIGFRGDQIVFNGVVKKPADLEYAIANDLYLINVDSLYELEHIDAISRKLKKVANVCVRVEPNVPSATHAELVTAFHAKSGLDLEQAEETCRRILAMPYVHLRGLHMHVGDQVPESEPFAKATKVLVDESRRLEEVLGIKFDLINVGGGIPVPYKYDDENGDPLKDNMYAGITAQDFADAVIREVHKWRTDVEICIEPGRKVTGSAAVLLTEVSCEKRKTNYDLNGNVECHVEWKFVDAGYSVLSDSQHFDWFFYVYNASRMTAAHDAWIKLAGPLSDGGDYFHMGVKGEEFLLPKETHVGDIVAFLDAGAYTIESQTVYNNRPRTGVVMIDKNGDTRLIRREDSYEDMVKYDIYLLAAALEHHHHHH
|
|
| PDBID: | 9cxy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with AVI-1500 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cxz | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with AVI-1501 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SARS-CoV-2 NSP3 macrodomain in complex with AVI-4206 | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9cy9 | | Status: | HOLD -- hold until a certain date | | Title: | Biofilm regulatory protein A from Streptococcus mutans | | Authors: | Hua, Z., Hui, W. | | Deposition date: | 2024-08-01 | | Release date: | 2025-08-01 |
|
| PDBID: | 9cy5 | | Status: | HPUB -- hold until publication | | Title: | Dyrk1a bound to a competitive inhibitor | | Authors: | Montfort, W.R. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gcg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gcb | | Status: | HPUB -- hold until publication | | Title: | Structure of IsDUF4198 | | Authors: | Franco Cairo, J.P.L., Correa, T.L.R., Offen, W.A., Nairn, A., Walton, J., Davies, G.J., Walton, P.H. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc2 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Arabidopsis thaliana PSI-LHCI- a603-NH mutant | | Authors: | Capaldi, S., Chaves-Sanjuan, A., Bonnet, D.M.V., Bassi, R. | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gce | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9gc7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-01 |
|
| PDBID: | 9iyw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iz8 | | Status: | HPUB -- hold until publication | | Title: | fungal unspecific peroxygenase from Thielavia terrestris | | Authors: | Lai, M.Y., Yu, H.L. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iym | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iys | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyt | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9iyu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
