| PDBID: | 9o3w | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3y | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3u | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3t | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3e | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o39 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the N-terminal and middle domain of E. coli HtpG bound AMPPNP | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3f | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3c | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a fully closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3a | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a semi-closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of I64A Variant of D-Dopachrome Tautomerase (D-DT) | | Authors: | Pilien, A.V.R., Argueta, C., Parkins, A., Pantouris, G. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3o | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with macrolide erythromycin, mRNA, aminoacylated A-site Lys-tRNAlys, P-site fMRC-peptidyl-tRNAmet, and deacylated E-site tRNAlys at 2.65A resolution | | Authors: | Syroegin, E.A., Aleksandrova, E.V., Kruglov, A.A., Paranjpe, M.N., Svetlov, M.S., Polikanov, Y.S. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with ketolide telithromycin, mRNA, aminoacylated A-site Lys-tRNAlys, P-site fMRC-peptidyl-tRNAmet, and deacylated E-site tRNAlys at 2.80A resolution | | Authors: | Syroegin, E.A., Aleksandrova, E.V., Kruglov, A.A., Paranjpe, M.N., Svetlov, M.S., Polikanov, Y.S. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type drug-free Thermus thermophilus 70S ribosome in complex with mRNA, aminoacylated A-site Lys-tRNAlys, P-site fMRC-peptidyl-tRNAmet, and deacylated E-site tRNAlys at 2.60A resolution | | Authors: | Syroegin, E.A., Aleksandrova, E.V., Kruglov, A.A., Paranjpe, M.N., Svetlov, M.S., Polikanov, Y.S. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with macrolide erythromycin, mRNA, aminoacylated A-site Lys-tRNAlys, P-site fMAC-peptidyl-tRNAmet, and deacylated E-site tRNAlys at 2.70A resolution | | Authors: | Syroegin, E.A., Aleksandrova, E.V., Kruglov, A.A., Paranjpe, M.N., Svetlov, M.S., Polikanov, Y.S. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with macrolide erythromycin, mRNA, deacylated A-site tRNAphe, P-site fMRC-peptidyl-tRNAmet, and deacylated E-site tRNAphe at 2.75A resolution | | Authors: | Syroegin, E.A., Aleksandrova, E.V., Kruglov, A.A., Paranjpe, M.N., Svetlov, M.S., Polikanov, Y.S. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3b | | Status: | HPUB -- hold until publication | | Title: | PKM2 bound to MCTI-566 | | Authors: | Stuckey, J.A. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3q | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3m | | Status: | HPUB -- hold until publication | | Title: | K40F mutant of hCRBPII bound to fentanyl | | Authors: | Bingham, C., Geiger, J.H. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
TRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTFVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
|
|
| PDBID: | 9o3p | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9qsy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
