| PDBID: | 9ugo | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9ugt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Butanol Dehydrogenase in Complex with ADP and Co | | Authors: | Bai, X., Meng, D., Nam, K.H., Xu, Y.B. | | Deposition date: | 2025-04-13 | | Release date: | 2025-10-13 |
|
| PDBID: | 9ugu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9ugw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Apo structure | | Authors: | Shuai, G., Xia, Y., Qian, W. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9ugx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Apo structure | | Authors: | Shuai, G., Xia, Y., Qian, W. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qvy | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme complex with mannose-1-phosphate (M1P) | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qw0 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Nostoc sp. 3335mg GT108 family enzyme D90A mutant complex with octyl-mannotetraose and Bis-Tris | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qw1 | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme D90A mutant complex with octyl-mannotetraose | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9ugv | | Status: | HPUB -- hold until publication | | Title: | CA structure | | Authors: | Shuai, G., Xia, Y., Qian, W. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9o6k | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9o6i | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9o6h | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9o6j | | Status: | HPUB -- hold until publication | | Title: | Structure of Siglec-10 in complex with 2,3-Sialyllactose | | Authors: | Medina, E., Ming, Q., Tran, T.H., Luca, V.C. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9o6e | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of SARS-CoV-2 Mpro S10C in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9o6g | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9o6f | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of SARS-CoV-2 Mpro S113A in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9ugl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9qvu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepI-(1,5)-KdoI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-12 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qvv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9qvw | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme native | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9ugn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9ugm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-12 | | Release date: | 2026-04-12 |
|
| PDBID: | 9ugh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | crystal structure of ferritin from pig spleen | | Authors: | Tuo, Z., Meng, C. | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9ugj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of SARM1 bound to SIR3-ADPR | | Authors: | Zhang, J., Zheng, S., Wang, X. | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9ugk | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of Rv0866 from Mycobacterium tuberculosis | | Authors: | Cho, H.J., Kang, B.S. | | Deposition date: | 2025-04-12 | | Release date: | 2026-04-12 |
|
