| PDBID: | 9s5c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Up class, Apo-state RyR1 in the native membrane solved by StA | | Authors: | Mikirtumov, V. | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9s5e | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tight class, Apo-state RyR1 in the native membrane solved by StA | | Authors: | Mikirtumov, V. | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9s5i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | anammox-specific heterodimeric ketoacyl-ACP synthase (amxFabFhet) from Brocadia fulgida in complex with its anammox-specific acyl carrier protein (amxACP) | | Authors: | Granatino, P., Barends, T. | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9s5b | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9s5p | | Status: | HPUB -- hold until publication | | Title: | Time-resolved SFX series of the DtpAa Y389F variant mixed with hydrogen peroxide -time 0.5 s | | Authors: | Williams, L.J., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2025-07-29 | | Sequence: | >Entity 1
DPAGADAGSAVPFHGAHQAGIATPVQDRLHFAAFDVTTEDRAAFVALLKEWTAAARRLTAGHAVGEGAYGGLPEAPPDDTGEALGLKPSRLTLTIGFGPSLFTRFGLADLRPEALADLPKFPGDNLDRARSGGDLCVQACADDPQVAVHAIRNLARIGFGKVVVRWSQLGFGKTSSTTPDKQTPRNLLGFKDGTRNIAGTEKDRLDRFVWAAEKDGTPWMTGGSYLVARRIRMHIETWDRASLQEQEDVFGRDKGEGAPVGKAKERDEPFLKAMKPDAHVRLAHPDSNGGATLLRRGYSFTDGTDGLGRLDAGLFFLAYQRDIRTGFVPVQRNLATDALNEFIQHVGSAVFAVPPGVRDADDWWGSTLFGKEA
|
|
| PDBID: | 9s5d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | diFe-Sulerythin_E53D:E126D O2-reacted | | Authors: | Jeoung, J.-H., Dobbek, H. | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9s5m | | Status: | HPUB -- hold until publication | | Title: | ADC-30 class C beta-lactamase in complex with taniborbactam | | Authors: | Hinchliffe, P., Spencer, J. | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9s5q | | Status: | HPUB -- hold until publication | | Title: | Time-resolved SFX series of the DtpAa Y389F variant mixed with hydrogen peroxide -time 1 s | | Authors: | Williams, L.J., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2025-07-29 | | Sequence: | >Entity 1
DPAGADAGSAVPFHGAHQAGIATPVQDRLHFAAFDVTTEDRAAFVALLKEWTAAARRLTAGHAVGEGAYGGLPEAPPDDTGEALGLKPSRLTLTIGFGPSLFTRFGLADLRPEALADLPKFPGDNLDRARSGGDLCVQACADDPQVAVHAIRNLARIGFGKVVVRWSQLGFGKTSSTTPDKQTPRNLLGFKDGTRNIAGTEKDRLDRFVWAAEKDGTPWMTGGSYLVARRIRMHIETWDRASLQEQEDVFGRDKGEGAPVGKAKERDEPFLKAMKPDAHVRLAHPDSNGGATLLRRGYSFTDGTDGLGRLDAGLFFLAYQRDIRTGFVPVQRNLATDALNEFIQHVGSAVFAVPPGVRDADDWWGSTLFGKEA
|
|
| PDBID: | 9s5l | | Status: | HPUB -- hold until publication | | Title: | ADC-30 class C beta-lactamase in complex with benzoxaborole AK-412 | | Authors: | Hinchliffe, P., Spencer, J. | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9s5k | | Status: | HPUB -- hold until publication | | Title: | ADC-30 class C beta-lactamase in a di-covalent complex with benzoxaborole AK-431 | | Authors: | Hinchliffe, P., Spencer, J. | | Deposition date: | 2025-07-29 |
|
| PDBID: | 9s5r | | Status: | HPUB -- hold until publication | | Title: | Time-resolved SFX series of the DtpAa Y389F variant mixed with hydrogen peroxide -time 5 s | | Authors: | Williams, L.J., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2025-07-29 | | Sequence: | >Entity 1
DPAGADAGSAVPFHGAHQAGIATPVQDRLHFAAFDVTTEDRAAFVALLKEWTAAARRLTAGHAVGEGAYGGLPEAPPDDTGEALGLKPSRLTLTIGFGPSLFTRFGLADLRPEALADLPKFPGDNLDRARSGGDLCVQACADDPQVAVHAIRNLARIGFGKVVVRWSQLGFGKTSSTTPDKQTPRNLLGFKDGTRNIAGTEKDRLDRFVWAAEKDGTPWMTGGSYLVARRIRMHIETWDRASLQEQEDVFGRDKGEGAPVGKAKERDEPFLKAMKPDAHVRLAHPDSNGGATLLRRGYSFTDGTDGLGRLDAGLFFLAYQRDIRTGFVPVQRNLATDALNEFIQHVGSAVFAVPPGVRDADDWWGSTLFGKEA
|
|
| PDBID: | 9ptc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-28 |
|
| PDBID: | 9ptb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-28 |
|
| PDBID: | 9pta | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-28 |
|
| PDBID: | 9pt9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-28 |
|
| PDBID: | 9pt8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-28 |
|
| PDBID: | 9pt7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of a P-loop mutant PTP-like myo-inositol phosphatase from Selenomonas ruminantium in complex with myo-inositol-(1,2,5,6)-tetrakisphosphate | | Authors: | Cleland, C.P., Mosimann, S.C. | | Deposition date: | 2025-07-28 | | Release date: | 2026-07-28 |
|
| PDBID: | 9pte | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-28 |
|
| PDBID: | 9ptf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-28 |
|
| PDBID: | 9ptd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of C. elegans PUF-3 | | Authors: | Zhang, Y., Hall, T.M.T. | | Deposition date: | 2025-07-28 |
|
| PDBID: | 9w2r | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of FoF1-ATPase monomer state 1 on the bovine heart submitochondrial particles (FoF1-1) | | Authors: | Nakano, A., Masuya, T., Akisada, S., Ishikawa-Fukuda, M., Mitsuoka, K., Miyoshi, H., Murai, M., Yokoyama, K. | | Deposition date: | 2025-07-28 |
|
| PDBID: | 9w2s | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of FoF1-ATPase monomer state 3 on the bovine heart submitochondrial particles (FoF1-2) | | Authors: | Nakano, A., Masuya, T., Akisada, S., Ishikawa-Fukuda, M., Mitsuoka, K., Miyoshi, H., Murai, M., Yokoyama, K. | | Deposition date: | 2025-07-28 |
|
| PDBID: | 9w2t | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Fo domain of FoF1-ATPase monomer state on the bovine heart submitochondrial particles | | Authors: | Nakano, A., Masuya, T., Akisada, S., Ishikawa-Fukuda, M., Mitsuoka, K., Miyoshi, H., Murai, M., Yokoyama, K. | | Deposition date: | 2025-07-28 |
|
| PDBID: | 9w2m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-28 |
|
| PDBID: | 9w32 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-07-28 |
|
