PDBID: | 8vcg | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcf | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcz | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vce | Status: | HPUB -- hold until publication | Title: | Crystal Structure of plant Carboxylesterase 20 | Authors: | Palayam, M., Shabek, N. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vd1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcv | Status: | AUTH -- processed, waiting for author review and approval | Title: | Lineage IV Lassa virus glycoprotein (Josiah) in complex with rabbit polyclonal antibody (GPC-C epitope) | Authors: | Brouwer, P.J.M., Perrett, H.R., Ward, A.B. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vd3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vd7 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcr | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 Spike S2 bound to Fab 54043-5 | Authors: | Johnson, N.V., McLellan, J.S. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcl | Status: | HPUB -- hold until publication | Title: | Crystal structure of HLA-A*03:01 in complex with a mutant PIK3CA peptide | Authors: | Ma, J., Baker, B.M. | Deposition date: | 2023-12-14 |
|
PDBID: | 8vdd | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcd | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcj | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vct | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vd6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vcx | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8vco | Status: | HPUB -- hold until publication | Title: | Crystal structure of rMcL-1 in complex with N-acetyl-D-galactosamine | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | Deposition date: | 2023-12-14 | Sequence: | >Entity 1 GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
PDBID: | 8vcy | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-14 |
|
PDBID: | 8xev | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus horikoshii | Authors: | Chen, Y.H., Chen, C.J. | Deposition date: | 2023-12-13 | Release date: | 2024-12-13 |
|
PDBID: | 8xex | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus horikoshii with AMP | Authors: | Chen, Y.H., Chen, C.J. | Deposition date: | 2023-12-13 | Release date: | 2024-12-13 |
|
PDBID: | 8xf5 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus horikoshii with ADP | Authors: | Chen, Y.H., Chen, C.J. | Deposition date: | 2023-12-13 | Release date: | 2024-12-13 |
|
PDBID: | 8xfe | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of defence-associated sirtuin 2 (DSR2) H171A protein in complex with DSR anti-defence 1(DSAD1) | Authors: | Li, Y., Zhang, H., Zheng, Q., Wu, Y., Li, S. | Deposition date: | 2023-12-13 |
|
PDBID: | 8xew | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of defence-associatedsirtuin 2 (DSR2) H171A protein | Authors: | Li, Y., Zhang, H., Zheng, Q., Wu, Y., Li, S. | Deposition date: | 2023-12-13 |
|
PDBID: | 8xff | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of defence-associatedsirtuin 2 (DSR2) H171A protein in complex with SPR phage tail tube protein | Authors: | Li, Y., Zhang, H., Zheng, Q., Wu, Y., Li, S. | Deposition date: | 2023-12-13 |
|
PDBID: | 8xfc | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the ATP-bound Mtb DppABCD with the D445A mutation of DppA | Authors: | Hu, T., Zhang, B., Rao, Z. | Deposition date: | 2023-12-13 |
|