| PDBID: | 8xhy | | Status: | HPUB -- hold until publication | | Title: | The complex structure of mutant T307A of SsBcmE and its natural substrate cIL | | Authors: | Wu, L., Tang, G.L., Zhou, J.H. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8pt9 | | Status: | HPUB -- hold until publication | | Title: | JNK1 covalently bound to BD838 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8xhz | | Status: | HPUB -- hold until publication | | Title: | protein-DNA complex | | Authors: | Li, Z. | | Deposition date: | 2023-12-18 |
|
| PDBID: | 9f18 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8pta | | Status: | HPUB -- hold until publication | | Title: | JNK1 covalently bound to BD837 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 9f14 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8xij | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-19 |
|
| PDBID: | 9f15 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8ptd | | Status: | HPUB -- hold until publication | | Title: | The surface-exposed lipo-protein of BtuG1 in complex with cyanocobalamin. | | Authors: | Whittaker, J., Felices Martinez, J.M., Guskov, A., Slotboom, D.J. | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8xi9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-19 |
|
| PDBID: | 9f13 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8xi4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-19 |
|
| PDBID: | 9f1a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8pts | | Status: | HPUB -- hold until publication | | Title: | human GUK1 in complex with compound AT8001 | | Authors: | Zimberger, C., Canard, B., Ferron, F. | | Deposition date: | 2023-07-14 | | Sequence: | >Entity 1
MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
|
|
| PDBID: | 8xi5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-19 |
|
| PDBID: | 9f19 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8ptf | | Status: | HPUB -- hold until publication | | Title: | The surface-exposed lipo-protein of BtuG2 in complex with cyanocobalamin. | | Authors: | Whittaker, J., Felices Martinez, J.M., Guskov, A., Slotboom, D.J. | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8xib | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-2HPA complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2023-12-19 |
|
| PDBID: | 9f6s | | Status: | HPUB -- hold until publication | | Title: | PDZ domain in complex with the peptide from AP2-associated protein kinase 1 | | Authors: | Benova, V., Boura, E. | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8pu1 | | Status: | HPUB -- hold until publication | | Title: | Structure of the toxin/antitoxin complex FaRel/ATfaRel2 with APCPP | | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | | Deposition date: | 2023-07-16 |
|
| PDBID: | 8xii | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH23011 complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2023-12-19 |
|
| PDBID: | 9f6q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-02 |
|
| PDBID: | 8pu2 | | Status: | HPUB -- hold until publication | | Title: | Structure of the antitoxin ATfaRel2 | | Authors: | Garcia-Pino, A., Talavera Perez, A., Dominguez Molina, L. | | Deposition date: | 2023-07-16 |
|
| PDBID: | 8xie | | Status: | HPUB -- hold until publication | | Title: | Archaeal exosome complex (Rrp4-Rrp41-Rrp42) | | Authors: | Kim, H.S., Park, S.H., Kim, S.H., Hwang, K.Y. | | Deposition date: | 2023-12-19 |
|
| PDBID: | 9f6x | | Status: | HPUB -- hold until publication | | Title: | TGF-beta Receptor type 1 in complex with SB505124 | | Authors: | Wolf-W, M., Buitrago, R.J.A. | | Deposition date: | 2024-05-02 |
|
