| PDBID: | 9f5p | | Status: | HPUB -- hold until publication | | Title: | Poliovirus type 2 (strain MEF-1) stabilised virus-like particle (PV2 SC6b) from an insect cell expression system. | | Authors: | Bahar, M.W., Porta, C., Fry, E.E., Stuart, D.I. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8pq6 | | Status: | HPUB -- hold until publication | | Title: | Streptococcus pyogenes GapN in complex with NADPH and glyceraldehyde-3-phosphate | | Authors: | Wirsing, R., Schindelin, H. | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 8xgl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 9f5s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8pq8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 8xgp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 9f6a | | Status: | HPUB -- hold until publication | | Title: | EVA71 E096A native particle | | Authors: | Kingston, N.J., Stonehouse, N.J., Rowlands, D.J., Hogle, J.M., Filman, D.J., Snowden, J.S.S. | | Deposition date: | 2024-04-30 |
|
| PDBID: | 9f5r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 | | Sequence: | >Entity 1
MGSSHHHHHHSAALEVLFQGPHMWTISKEYHIDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLIESGQLRERVEKLNMLSIDHLTDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPNKPLTYENMDVLFSFRDGDCSKGFFLVSLLVEIAAASAIKVIPTVFKAMQMQERDTLLKALLEIASCLEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWEDPKEFAGGSAGQSSVFQCFDVLLGIQQTAGGGHAAQFLQDMRRYMPPAHRNFLCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG
|
|
| PDBID: | 8xgn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 9f5t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8xgq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xgs | | Status: | HPUB -- hold until publication | | Title: | a peptide receptor complex structure | | Authors: | Wu, Z., Du, Y., Chen, G. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 8xgu | | Status: | HPUB -- hold until publication | | Title: | a peptide receptor complex structure | | Authors: | Wu, Z., Du, Y., Chen, G. | | Deposition date: | 2023-12-15 |
|
| PDBID: | 9f5z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8xgz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-16 |
|
| PDBID: | 9f60 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8xh0 | | Status: | HPUB -- hold until publication | | Title: | Monoclinic crystal structure of green fluorescent protein nowGFP at pH 4.8 | | Authors: | Kim, C.U., Kim, J.K. | | Deposition date: | 2023-12-16 |
|
| PDBID: | 9f61 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8xh1 | | Status: | HPUB -- hold until publication | | Title: | Orthorhombic crystal structure of green fluorescent protein nowGFP at pH 9.0 | | Authors: | Kim, C.U., Kim, J.K. | | Deposition date: | 2023-12-16 |
|
| PDBID: | 9f67 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8xh2 | | Status: | HPUB -- hold until publication | | Title: | Orthorhombic crystal structure of green fluorescent protein nowGFP at pH 6.0 | | Authors: | Kim, C.U., Kim, J.K. | | Deposition date: | 2023-12-16 |
|
| PDBID: | 8pqm | | Status: | HPUB -- hold until publication | | Title: | The DNA-binding domain of L-lactate utilization repressor (LutR-DBD) from Bacillus subtilis | | Authors: | Soltysova, M. | | Deposition date: | 2023-07-11 | | Release date: | 2025-01-17 |
|
| PDBID: | 8k1e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-11 | | Release date: | 2025-01-11 |
|
| PDBID: | 9f5u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Heme-Oxygenase from Corynebacterium diphtheriae complexed with Cobalt-porphyrine (HumO-Co(III)) | | Authors: | Labidi, R.J., Faivre, B., Carpentier, P., Perard, J., Gotico, P., Li, Y., Atta, M., Fontecave, M. | | Deposition date: | 2024-04-30 |
|
| PDBID: | 9f5v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thiol peroxidase from Helicobacter pylori (HpTx, reduced) | | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | | Deposition date: | 2024-04-30 | | Sequence: | >Entity 1
MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|
