| PDBID: | 8vjt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8gix | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-14 | | Release date: | 2024-09-11 |
|
| PDBID: | 9euh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8vk7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 9eui | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8vkb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 9euj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8vka | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-08 |
|
| PDBID: | 9euk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8wf8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-19 |
|
| PDBID: | 9eul | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8vlp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 9etx | | Status: | HPUB -- hold until publication | | Title: | KEAP1 BTB in complex with compound 23 | | Authors: | Richardson, W., Bullock, A.N., Rothweiler, E.M., Manning, C.E., Sweeney, M.N., Chalk, R., Huber, K.V.M. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8vd0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 8gdt | | Status: | HPUB -- hold until publication | | Title: | Heligmosomoides polygyrus TGF-beta Mimic 6 Domain 3 (TGM6-D3) Bound to Human TGF-beta Type II Receptor Extracellular Domain | | Authors: | White, S.E., Schwartze, T.A., Hinck, A.P. | | Deposition date: | 2023-03-06 | | Release date: | 2024-09-11 |
|
| PDBID: | 9ety | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8vlw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-12 |
|
| PDBID: | 8cqj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-06 | | Release date: | 2024-09-06 |
|
| PDBID: | 9eu0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9etu | | Status: | HPUB -- hold until publication | | Title: | Archaellum filament from the Halobacterium salinarum deltaAgl27 strain | | Authors: | Grossman-Haham, I., Shahar, A. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9eu3 | | Status: | HPUB -- hold until publication | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 | | Sequence: | >Entity 1
MPAQPGYTPSADNLKARETFQDDKFGIFIHWGIYSMLADGEWVMHNKNLNWEEYAKLASGFYPAKFNAAEWVAAIKASGAKYITITSRHHDGFSMYATQQSDYNIVDATPFKRDVIHELADECRKQGIRLHLYYSHLDWRRDDYYPLGRTGKGTGRTTQGKWEDYCAFMNNQLTELLTNYGLIGAIWFDGMWDKDIYPDGMTAKTWNLNEQYTLIHRLQPACLIGNNHHITPFAGEDIQIFERDLPGENKAGLSGQDISRLPLETCETMNGMWGYKITDQDYKSTKILIQYLVKAAGKNANLLMNVGPQPNGELPTVAVQRLREMGEWMKIYAPTIQGTRGGVVTPRDWGVTTQKGKTLYVHVLNLDDKALFLPYAGNKLKSAVEYQSRKSVRFIQDRDGILLKFTDKPHSPDYVLELTFANELPLNLEHHHHHH
|
|
| PDBID: | 8vn7 | | Status: | HPUB -- hold until publication | | Title: | Homing endonuclease I-PpoI-DNA complex:reaction at pH8.0 (Tris) with 500 uM Mg2+ for 20s | | Authors: | Chang, C., Gao, Y. | | Deposition date: | 2024-01-13 |
|
| PDBID: | 8cre | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-08 | | Release date: | 2024-09-08 |
|
| PDBID: | 9eu2 | | Status: | HPUB -- hold until publication | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 | | Sequence: | >Entity 1
MPAQPGYTPSADNLKARETFQDDKFGIFIHWGIYSMLADGEWVMHNKNLNWEEYAKLASGFYPAKFNAAEWVAAIKASGAKYITITSRHHDGFSMYATQQSDYNIVDATPFKRDVIHELADECRKQGIRLHLYYSHLDWRRDDYYPLGRTGKGTGRTTQGKWEDYCAFMNNQLTELLTNYGLIGAIWFDGMWDKDIYPDGMTAKTWNLNEQYTLIHRLQPACLIGNNHHITPFAGEDIQIFERDLPGENKAGLSGQDISRLPLETCETMNGMWGYKITDQDYKSTKILIQYLVKAAGKNANLLMNVGPQPNGELPTVAVQRLREMGEWMKIYAPTIQGTRGGVVTPRDWGVTTQKGKTLYVHVLNLDDKALFLPYAGNKLKSAVEYQSRKSVRFIQDRDGILLKFTDKPHSPDYVLELTFANELPLNLEHHHHHH
|
|
| PDBID: | 8vf5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-21 |
|
