| PDBID: | 8vz3 | | Status: | HPUB -- hold until publication | | Title: | Structure of human PIN1 covalently derivatized with SuFEx compound | | Authors: | Louie, G.V., Noel, J.P., Wang, W.-M., Kelly, J.W. | | Deposition date: | 2024-02-09 |
|
| PDBID: | 9ewu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8vz2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-09 |
|
| PDBID: | 9ewz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the E. coli BrxX methyltransferase in complex with DNA | | Authors: | Adams, M.C., Ghilarov, D. | | Deposition date: | 2024-04-05 |
|
| PDBID: | 8ole | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM reconstruction of VP4 assembly from SA11 Rotavirus Non-Tripsinized Triple Layered Particle | | Authors: | Asensio-Cob, D., Perez-Mata, C., Gomez-Blanco, J., Vargas, J., Rodriguez, J.M., Luque, D. | | Deposition date: | 2023-03-30 | | Release date: | 2024-09-30 |
|
| PDBID: | 9ex5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-05 |
|
| PDBID: | 8vzi | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of 2-Hydroxyacyl-CoA Lyase/Synthase CcHACS from Conidiobolus coronatus in the Complex with THDP and ADP | | Authors: | Kim, Y., Gade, P., Endres, M., Lee, S., Yoshikuni, Y., Gonzalez, R., Michalska, K., Joachimiak, A. | | Deposition date: | 2024-02-11 | | Sequence: | >Entity 1
MSQEQLTGSSILAKSLKSLGVDVIFGIVGVPVVEVAEACIAEGIRFIGCRNEQSASFAAGAWGYLNKRPGVCLTVSGPGVVNAISGLYNAQANCWPMILIGGSCETNQIGMGAFQELDQVDACRNYTKFSGKCADLETIPFIVNKAYQVSKAGRPGPTYVDLPADLIQATTSKLPKLPEPFETPYCLPHTKDLSAAIEILKNSKRPLLVVGKGATYSRCENELKALVEEFNVPFLPTPMAKGILPDNHSLNAGSARSLALRKADVIVLLGARLNWMMQFGNRLNPQTKIIHVDISPEEFNINKKIDIGLFGNIPETIELIHQGLKKSGKSYSWIHFKNELQPNIEKNQEKLQKFLTAPLSPLMNHQQALNTVEEVLSKQFNGDYFLVSEGARTMDVTRMLVSSHLPRRRLDAGTLGVMGIGLGYALAGQLTHPDKKVVAIMGDSAFGFSAMEIETAARCKLPLIIIIINNNGIYHGLDDIKSVPSDKLPSFTLMPETRYDLLANSVYGQGFLVKDSTQLQSALQKCFNFDGVSIVNVMIDHRPASEGLYWLTREFSPAGQSKL
|
|
| PDBID: | 8omj | | Status: | HPUB -- hold until publication | | Title: | hKHK-C in complex with cpd 37 | | Authors: | Pautsch, A., Ebenhoch, R. | | Deposition date: | 2023-03-31 | | Release date: | 2024-06-30 |
|
| PDBID: | 8vsc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8vsd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-23 |
|
| PDBID: | 8op7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 9exd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-07 |
|
| PDBID: | 8vsu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of LKB1-STRADalpha-MO25alpha heterocomplex | | Authors: | Chan, L.M., Courteau, B.J., Verba, K.A. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8op8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 8op6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 8w5x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-28 |
|
| PDBID: | 8op4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 8vhi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-02 |
|
| PDBID: | 8op3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 9exm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-08 |
|
| PDBID: | 8vj1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8opp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-07 | | Release date: | 2024-07-10 |
|
| PDBID: | 9exh | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the Apo E. coli BrxX methyltransferase | | Authors: | Adams, M.C., Ghilarov, D. | | Deposition date: | 2024-04-08 |
|
| PDBID: | 8vkc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dehaloperoxidase A in complex with substrate 4-nitrophenol | | Authors: | Aktar, M.S., de Serrano, V.S., Ghiladi, R.A., Franzen, S. | | Deposition date: | 2024-01-08 |
|
| PDBID: | 8ops | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-08 | | Release date: | 2024-10-10 |
|
