| PDBID: | 8vbi | | Status: | HPUB -- hold until publication | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 9euq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8vta | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-26 |
|
| PDBID: | 9evc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8vco | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rMcL-1 in complex with N-acetyl-D-galactosamine | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 9euy | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the full-length Pseudomonas aeruginosa bacteriophytochrome in its Pfr state | | Authors: | Bodizs, S., Westenhoff, S. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8vcp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of dimeric rMcL-1 in complex with raffinose | | Authors: | Hernandez-Santoyo, A., Loera-Rubalcava, J. | | Deposition date: | 2023-12-14 | | Sequence: | >Entity 1
GHMTTFLIKHKASGKFLHPKGGSSNPANDTNLVLHSDIHERMYFQFDVVDERWGYIKHAASGKIVHPLGGKADPPNETKLVLHQDRHDRALFAMDFFNDNIIHKAGKYIHPKGGSTNPPNETLTVMHGDKHKAMEFIFVSPKDKDKRVLVYV
|
|
| PDBID: | 8vcy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-14 |
|
| PDBID: | 9ev1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8vuy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-30 |
|
| PDBID: | 9ev7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8vv0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-30 |
|
| PDBID: | 9evb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9ev9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 9evg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-29 |
|
| PDBID: | 8cq5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-03-03 | | Release date: | 2024-09-03 |
|
| PDBID: | 9evf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-29 |
|
| PDBID: | 8vvj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-31 |
|
| PDBID: | 9evd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-29 |
|
| PDBID: | 8vw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-31 |
|
| PDBID: | 8ixn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-01 | | Release date: | 2024-10-01 |
|
| PDBID: | 9eve | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ARM domain of human ZNFX1 | | Authors: | Grabarczyk, D.B., Deszcz, L., Clausen, T. | | Deposition date: | 2024-03-29 |
|
| PDBID: | 8vvy | | Status: | HPUB -- hold until publication | | Title: | Human Cullin-1 in complex with CAND2 | | Authors: | Kenny, S., Liu, X., Das, C. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 9evj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-30 |
|
| PDBID: | 8vw6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-31 |
|
