PDBID: | 8vbq | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-12 |
|
PDBID: | 9ete | Status: | HPUB -- hold until publication | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with deoxycholic acid | Authors: | Tassone, G., Pozzi, C. | Deposition date: | 2024-03-26 | Sequence: | >Entity 1 GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
PDBID: | 9etf | Status: | HPUB -- hold until publication | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with lithocholic acid | Authors: | Tassone, G., Pozzi, C. | Deposition date: | 2024-03-26 | Sequence: | >Entity 1 GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
PDBID: | 8vca | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-13 |
|
PDBID: | 9etg | Status: | HPUB -- hold until publication | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with CA-M11 | Authors: | Tassone, G., Pozzi, C., Maramai, S. | Deposition date: | 2024-03-26 | Sequence: | >Entity 1 GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
PDBID: | 8vcb | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-13 |
|
PDBID: | 9eti | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9esm | Status: | HPUB -- hold until publication | Title: | Archaellum filament from the Halobacterium salinarum deltaAgl26 strain | Authors: | Grosmann-Haham, I., Shahar, A. | Deposition date: | 2024-03-26 |
|
PDBID: | 9etm | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 8vdu | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-17 |
|
PDBID: | 9eth | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9ett | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 8vgm | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-27 |
|
PDBID: | 9etk | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 8vgn | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-27 |
|
PDBID: | 8vh0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-30 |
|
PDBID: | 9etr | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9etq | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 9ets | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 8vj9 | Status: | HPUB -- hold until publication | Title: | CryoEM structure of human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 variant with the C edge loop from Arrestin2 inserted | Authors: | Chen, Q., Tesmer, J.J.G. | Deposition date: | 2024-01-06 | Release date: | 2025-01-22 |
|
PDBID: | 9etw | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-27 |
|
PDBID: | 9etv | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-27 |
|
PDBID: | 9euf | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-27 |
|
PDBID: | 8vjy | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-08 |
|
PDBID: | 9eug | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-27 |
|