| PDBID: | 8w3r | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of prefusion-stabilized RSV F protein UFCR2-iSS-P2-NQ in complex with A4 single-chain fragment variable | | Authors: | Lee, Y.Z., Stanfield, R.L., Wilson, I.A., Zhu, J. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9erb | | Status: | HPUB -- hold until publication | | Title: | Hydrogenase-2 Ni-B state | | Authors: | Carr, S.B., Li, W., Wong, K.l., Ash, P.A., Vincent, K.A. | | Deposition date: | 2024-03-22 | | Sequence: | >Entity 1
MAESVTNPQRPPVIWIGAQECTGCTESLLRATHPTVENLVLETISLEYHEVLSAAFGHQVEENKHNALEKYKGQYVLVVDGSIPLKDNGIYCMVAGEPIVDHIRKAAEGAAAIIAIGSCSAWGGVAAAGVNPTGAVSLQEVLPGKTVINIPGCPPNPHNFLATVAHIITYGKPPKLDDKNRPTFAYGRLIHEHCERRPHFDAGRFAKEFGDEGHREGWCLYHLGCKGPETYGNCSTLQFCDVGGVWPVAIGHPCYGCNEEGIGFHKGIHQLANVENQTPRSQKPDVNAKEGGHHHHHH
>Entity 2
MSQRITIDPVTRIEGHLRIDCEIENGVVSKAWASGTMWRGMEEIVKNRDPRDAWMIVQRICGVCTTTHALSSVRAAESALNIDVPVNAQYIRNIILAAHTTHDHIVHFYQLSALDWVDITSALQADPTKASEMLKGVSTWHLNSPEEFTKVQNKIKDLVASGQLGIFANGYWGHPAMKLPPEVNLIAVAHYLQALECQRDANRVVALLGGKTPHIQNLAVGGVANPINLDGLGVLNLERLMYIKSFIDKLSDFVEQVYKVDTAVIAAFYPEWLTRGKGAVNYLSVPEFPTDSKNGSFLFPGGYIENADLSSYRPITSHSDEYLIKGIQESAKHSWYKDEAPQAPWEGTTIPAYDGWSDDGKYSWVKSPTFYGKTVEVGPLANMLVKLAAGRESTQNKLNEIVAIYQKLTGNTLEVAQLHSTLGRIIGRTVHCCELQDILQNQYSALITNIGKGDHTTFVKPNIPATGEFKGVGFLEAPRGMLSHWMVIKDGIISNYQAVVPSTWNSGPRNFNDDVGPYEQSLVGTPVADPNKPLEVVRTIHSFDPCMACAVHVVDADGNEVVSVKVL
|
|
| PDBID: | 8w40 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9erc | | Status: | HPUB -- hold until publication | | Title: | Hydrogenase-2 Ni-Li state | | Authors: | Wong, K.L., Carr, S.B., Ash, P.A., Vincent, K.A. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8w3z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9erh | | Status: | HPUB -- hold until publication | | Title: | Uhgb_MS mannoside synthase from an unknown human gut bacterium in complex with 1,2-beta-mannobiose | | Authors: | Cioci, G., Ladeveze, S., Potocki-Veronese, G. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8w3y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a computationally designed metalloprotein containing the metal-chelating, fluorogenic, non-canonical amino acid 3-(8-hydroxyquinolin-3-yl)-L-alanine: apo form | | Authors: | Kelly, P.I., Henderson, J.N., Mills, J.H. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9emg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-08 |
|
| PDBID: | 8w38 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-22 |
|
| PDBID: | 8w3b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9erj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-23 |
|
| PDBID: | 8w3d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9eri | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-23 |
|
| PDBID: | 8w39 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9erk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-23 |
|
| PDBID: | 8w37 | | Status: | HPUB -- hold until publication | | Title: | Structure and interactions of HIV-1 gp41 CHR-NHR reverse hairpin constructs reveal molecular determinants of antiviral activity | | Authors: | McAndrew, R.P., Ralston, C.Y., Gochin, M. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 8w3u | | Status: | HPUB -- hold until publication | | Title: | Structure of Epimerase Mth373 from the thermophilic pseudomurein-containing methanogen Methanothermobacter thermautotrophicus | | Authors: | Carbone, V., Schofield, L.R., Sutherland-Smith, A.J., Ronimus, R.S. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9es8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-25 |
|
| PDBID: | 9es7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-25 |
|
| PDBID: | 9es9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8vz6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-10 |
|
| PDBID: | 9es6 | | Status: | HPUB -- hold until publication | | Title: | ADP:BeF3-bound human mitochondrial Hsp60 double-ring complex | | Authors: | Lopez-Alonso, J.P., Tascon, I., Ubarretxena-Belandia, I., Shkolnisky, Y. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 9es5 | | Status: | HPUB -- hold until publication | | Title: | ADP:BeF3-bound human mitochondrial Hsp60-Hsp10 half-football complex | | Authors: | Lopez-Alonso, J.P., Tascon, I., Ubarretxena-Belandia, I., Shkolnisky, Y. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 9es4 | | Status: | HPUB -- hold until publication | | Title: | ADP:BeF3-bound human mitochondrial Hsp60-Hsp10 football complex | | Authors: | Lopez-Alonso, J.P., Tascon, I., Ubarretxena-Belandia, I., Shkolnisky, Y. | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8vzg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-11 |
|
