| PDBID: | 8s7q | | Status: | HOLD -- hold until a certain date | | Title: | Vanillyl-alcohol dehydrogenase from Marinicaulis flavus: P151I mutant | | Authors: | Guerriere, T.B., Mattevi, A. | | Deposition date: | 2024-03-04 | | Release date: | 2025-03-04 |
|
| PDBID: | 8s7r | | Status: | HOLD -- hold until a certain date | | Title: | Vanillyl-alcohol dehydrogenase from Marinicaulis flavus: P151T mutant | | Authors: | Guerriere, T.B., Mattevi, A. | | Deposition date: | 2024-03-04 | | Release date: | 2025-03-04 |
|
| PDBID: | 8s7s | | Status: | HOLD -- hold until a certain date | | Title: | Vanillyl-alcohol dehydrogenase from Marinicaulis flavus: P151G mutant | | Authors: | Guerriere, T.B., Mattevi, A. | | Deposition date: | 2024-03-04 | | Release date: | 2025-03-04 |
|
| PDBID: | 8s7t | | Status: | HOLD -- hold until a certain date | | Title: | Vanillyl-alcohol dehydrogenase from Marinicaulis flavus: P151N mutant | | Authors: | Guerriere, T.B., Mattevi, A. | | Deposition date: | 2024-03-04 | | Release date: | 2025-03-04 |
|
| PDBID: | 8s7u | | Status: | HOLD -- hold until a certain date | | Title: | Vanillyl-alcohol dehydrogenase from Marinicaulis flavus: P151L mutant | | Authors: | Guerriere, T.B., Mattevi, A. | | Deposition date: | 2024-03-04 | | Release date: | 2025-03-04 |
|
| PDBID: | 8s7w | | Status: | HOLD -- hold until a certain date | | Title: | Vanillyl-alcohol dehydrogenase from Marinicaulis flavus: P151V mutant | | Authors: | Guerriere, T.B., Mattevi, A. | | Deposition date: | 2024-03-04 | | Release date: | 2025-03-04 |
|
| PDBID: | 8z7a | | Status: | HOLD -- hold until a certain date | | Title: | Open Barrel Structure of Translin from Trichoderma virens | | Authors: | Kumari, S., Gupta, G.D. | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAAPPPALLDPSIFASLEAKLEEETQIRDTLSQLIQRLDRAVATAQGLLSRVHSTPRSRYPQLVSQVEAAVKEEAAIISELDTVASKHPYYKYNQRWTRSMQHAIGTAIYCAWLGGFPSQSSESEASSPAEIGRLLTLEEVGTIFSVPTNLKDRDAFHITIEEYLLSLVDLTQDLSRLATNSVTLGDFQLPLTISAFVKDLFAGFQLLNLKNDIIRKRADSVKYEVKRVEDIVYDLSLRGLIQRPGAGDTEMEAAE
|
|
| PDBID: | 8z6e | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8z6d | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8z7c | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-20 | | Release date: | 2025-04-20 |
|
| PDBID: | 8z7e | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-20 | | Release date: | 2025-04-20 |
|
| PDBID: | 8z7r | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
| PDBID: | 8z7t | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
| PDBID: | 8z7u | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
| PDBID: | 8z7v | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
| PDBID: | 8z7w | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
| PDBID: | 8z80 | | Status: | HOLD -- hold until a certain date | | Title: | SLC19A2-Pyridoxine inward structure | | Authors: | Li, P.P., Zhu, Z.N., Wang, Y., Gao, P., Qu, Q.H. | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
| PDBID: | 8z7y | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
| PDBID: | 8z7s | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
| PDBID: | 8z8l | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-22 | | Release date: | 2025-04-22 |
|
| PDBID: | 8t7r | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human leukocyte antigen A*0101 in complex with the Fab of alloreactive antibody E07 | | Authors: | Green, T.J., Killian Jr, J.T., Qiu, S., Macon, K.J., Yang, G., King, R.G., Lund, F.E. | | Deposition date: | 2023-06-21 | | Release date: | 2024-12-21 |
|
| PDBID: | 8t8j | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-06-22 | | Release date: | 2024-12-18 |
|
| PDBID: | 8z8y | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-22 | | Release date: | 2025-04-22 |
|
| PDBID: | 8z92 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-22 | | Release date: | 2025-04-22 |
|
| PDBID: | 8z96 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-22 | | Release date: | 2025-04-22 |
|
