| PDBID: | 8x1g | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-07 | | Release date: | 2024-11-07 |
|
| PDBID: | 9f2q | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-23 | | Release date: | 2025-04-23 |
|
| PDBID: | 8pn4 | | Status: | HOLD -- hold until a certain date | | Title: | transcription factor BARHL2 bound to DNA sequences | | Authors: | Morgunova, E., Yin, Y., Popov, A., Taipale, J. | | Deposition date: | 2023-06-29 | | Release date: | 2024-06-29 |
|
| PDBID: | 8wkv | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-28 | | Release date: | 2024-09-28 |
|
| PDBID: | 8ws8 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8wrv | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 9f49 | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the bacteriophage K gp155 C-terminal domain, seleno-methionine modified version | | Authors: | Pichel, A., van Raaij, M.J. | | Deposition date: | 2024-04-26 | | Release date: | 2024-06-21 | | Sequence: | >Entity 1
KDF(MSE)LIGHRGATGYTDEHTIKGYQ(MSE)ALDKGADYIELDLQLTKDNKLLC(MSE)HDSTIDRTTTGTGKVGD(MSE)TLSYIQTNFTSLNGEPIPSLDDVLNHFGTKVKYYIETKRPFDAN(MSE)DRELLTQLKAKGLIGIGSERFQVIIQSFARESLINIHNQFSNIPLAYLTSTFSESE(MSE)DDCLSYGFYAIAPKYTTITKELVDLAHSKGLKVHAWTVNTKEE(MSE)QSLIQ(MSE)GVDGFFTNYLDEYKKI
|
|
| PDBID: | 8wru | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8k52 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-20 | | Release date: | 2024-08-17 |
|
| PDBID: | 8k6e | | Status: | HOLD -- hold until a certain date | | Title: | LnaB-Actin-PRUb ternary complex | | Authors: | Chen, T.T., Ouyang, S.Y. | | Deposition date: | 2023-07-25 | | Release date: | 2024-07-25 |
|
| PDBID: | 8ww6 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-25 | | Release date: | 2024-10-25 |
|
| PDBID: | 8q06 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-27 | | Release date: | 2024-07-27 |
|
| PDBID: | 8wn2 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-05 | | Release date: | 2024-10-05 |
|
| PDBID: | 8kbf | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8kbg | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8kbh | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8k6n | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-25 | | Release date: | 2024-07-25 |
|
| PDBID: | 9f7e | | Status: | HOLD -- hold until a certain date | | Title: | CtdA Canavanine tRNA-editing deacetylase from Pseudomonas canavaninivorans | | Authors: | Tabagari, N., Mayans, O. | | Deposition date: | 2024-05-03 | | Release date: | 2025-05-03 |
|
| PDBID: | 8kbi | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8wsk | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of SARS-Cov-2 main protease, pH=8.5 | | Authors: | Jiang, H.H., Zhou, X.L., Zhang, J., Li, J. | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8jlt | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the Green fluorescent protein SET203EF223DA227 variant at pH 7.0 | | Authors: | Shin, S.C., Shin, S.C. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-01 |
|
| PDBID: | 8jlu | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the Green fluorescent protein SET203EF223DA227 variant at pH 8.5 | | Authors: | Shin, S.C., Shin, S.C. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-01 |
|
| PDBID: | 8jl5 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the Green fluorescent protein SEA227D variant at pH 4.5 | | Authors: | Shin, S.C., Shin, S.C. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-01 |
|
| PDBID: | 8jl6 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the Green fluorescent protein SEA227D variant at pH 5.5 | | Authors: | Shin, S.C., Shin, S.C. | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-01 |
|
| PDBID: | 8wxi | | Status: | HOLD -- hold until a certain date | | Title: | human CLC-1 D136G delayed rectification | | Authors: | Zhang, M.F. | | Deposition date: | 2023-10-29 | | Release date: | 2024-10-29 |
|
