| PDBID: | 8p7y | | Status: | HPUB -- hold until publication | | Title: | Mycoplasma pneumoniae 70S ribosome with second S4 protein on large subunit | | Authors: | Schacherl, M., Xue, L., Spahn, C.M.T., Mahamid, J. | | Deposition date: | 2023-05-31 | | Release date: | 2024-11-30 |
|
| PDBID: | 8x99 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of coxsackievirus A16 A-particle in complex with Fab h1A6.2 | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9ezu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8x9a | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of coxsackievirus A16 empty particle in complex with Fab h1A6.2 | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 8x9b | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of coxsackievirus A16 empty particle in complex with Fab h1A6.2 (local refinement) | | Authors: | Jiang, Y., Huang, Y., Zhu, R., Zheng, Q., Li, S., Xia, N. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9ezv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8x8x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ROCK2 with GNS-2591 inhibitor | | Authors: | Park, T.H., Bong, S.M., Lee, S.J., Lee, B.I. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9ezw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-14 |
|
| PDBID: | 8x8y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ROCK2 with GNS-2660 inhibitor | | Authors: | Park, T.H., Bong, S.M., Lee, S.J., Lee, B.I. | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9f04 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8x8z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-29 |
|
| PDBID: | 9f05 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9f06 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9f0d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9f08 | | Status: | HPUB -- hold until publication | | Title: | Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii. Covalent complex with 2-deoxyribose. | | Authors: | Ascham, A., Salihovic, A., Burley, G., Grogan, G. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8p8o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-06-02 | | Release date: | 2024-12-02 |
|
| PDBID: | 8x9i | | Status: | HPUB -- hold until publication | | Title: | Solution structure of free PDL1 promoter G-quadruplex | | Authors: | Liu, Y.S., Wang, K.B. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9f02 | | Status: | HPUB -- hold until publication | | Title: | HIV-1 envelope glycoprotein (BG505 gp140 SOSIP.664) trimer in complex with three copies of ELC07 broadly neutralizing antibody. | | Authors: | Hope, J., Alguel, Y., Nans, A., Cherepanov, P. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8x9n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9f07 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8x9p | | Status: | HPUB -- hold until publication | | Title: | HURP (428-534)-alpha-tubulin-beta-tubulin complex | | Authors: | Chen, P.-P., Hsia, K.-C. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9f09 | | Status: | HPUB -- hold until publication | | Title: | Nucleoside-2''-deoxyribosyltransferase from Lactobacillus leichmannii. Complex with 2-deoxyribose, 7-Bromo-1H-imidazo[4,5-b]pyridine and 2''-deoxycytidine | | Authors: | Ascham, A., Salihovic, A., Burley, G., Grogan, G. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9f0a | | Status: | HPUB -- hold until publication | | Title: | N5 Adduct of LSD1-CoREST in complex with MC4455 | | Authors: | Barone, M., Mattevi, A. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9eu1 | | Status: | HPUB -- hold until publication | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 | | Sequence: | >Entity 1
MQQKYQPTEANLKARSEFQDNKFGIFLHWGLYAMLATGEWTMTNNNLNYKEYAKLAGGFYPSKFDADKWVAAIKASGAKYICFTTRHHEGFSMFDTKYSDYNIVKATPFKRDVVKELADACAKHGIKLHFYYSHIDWYREDAPQGRTGRRTGRPNPKGDWKSYYQFMNNQLTELLTNYGPIGAIWFDGWWDQDINPDFDWELPEQYALIHRLQPACLVGNNHHQTPFAGEDIQIFERDLPGENTAGLSGQSVSHLPLETCETMNGMWGYKITDQNYKSTKTLIHYLVKAAGKDANLLMNIGPQPDGELPEVAVQRLKEVGEWMSKYGETIYGTRGGLVAPHDWGVTTQKGNKLYVHILNLQDKALFLPIVDKKVKKAVVFADKTPVRFTKNKEGIVLELAKVPTDVDYVVELTIDLEHHHHHH
|
|
| PDBID: | 9etz | | Status: | HPUB -- hold until publication | | Title: | III2IV respiratory supercomplex from Saccharomyces cerevisiae | | Authors: | Moe, A., Brzezinski, P. | | Deposition date: | 2024-03-27 |
|
