| PDBID: | 9fli | | Status: | HOLD -- hold until a certain date | | Title: | The structure of GanA, the extracellular galactanase of G.proteiniphilus T-6 | | Authors: | Hadad, N., Lavid, N., Shulami, S., Dessau, M., Shoham, Y., Shoham, G. | | Deposition date: | 2024-06-05 | | Release date: | 2025-06-05 |
|
| PDBID: | 8k9h | | Status: | HOLD -- hold until a certain date | | Title: | Complex structure of Acetoacetate:butyrate/acetate coenzyme A transferase and Butyrate-acetoacetate CoA-transferase subunit B from Fusobacterium nucleatum ATCC 25586 | | Authors: | Bai, X., Zhao, Z.D., Xu, Y.B. | | Deposition date: | 2023-08-01 | | Release date: | 2024-08-01 |
|
| PDBID: | 8jz9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8qxr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-24 | | Release date: | 2024-10-24 |
|
| PDBID: | 9fms | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-06-07 | | Release date: | 2025-06-07 |
|
| PDBID: | 8y7v | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of CP2c/LSF DNA-binding domain | | Authors: | Park, J., Lee, S.J., Won, H.S., Lee, S.H., Lee, S.H., Kim, S.J., Lee, S.I. | | Deposition date: | 2024-02-05 | | Release date: | 2025-02-05 |
|
| PDBID: | 9fn5 | | Status: | HOLD -- hold until a certain date | | Title: | The REC domain (in the non-phosphorylated state) of XynC, a response regulator from G.proteiniphilus T-6 | | Authors: | Hadad, N., Lavid, N., Pazy, Y., Hiya, D., Shoham, Y., Shoham, G. | | Deposition date: | 2024-06-09 | | Release date: | 2025-06-09 |
|
| PDBID: | 8y9f | | Status: | HOLD -- hold until a certain date | | Title: | ATAT-2 bound MEC-12/MEC-7 microtubule | | Authors: | Lam, W.H., Yu, D., Zhai, Y., Ti, S. | | Deposition date: | 2024-02-06 | | Release date: | 2025-02-06 |
|
| PDBID: | 9fnk | | Status: | HOLD -- hold until a certain date | | Title: | The structure of CBM42 from Clostridium thermocellum | | Authors: | Hadad, N., Lavid, N., Shoham, Y., Shoham, G. | | Deposition date: | 2024-06-10 | | Release date: | 2025-06-10 |
|
| PDBID: | 8y9n | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-07 | | Release date: | 2025-02-07 |
|
| PDBID: | 8y9m | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-07 | | Release date: | 2025-02-07 |
|
| PDBID: | 8y9o | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-07 | | Release date: | 2025-02-07 |
|
| PDBID: | 8yal | | Status: | HOLD -- hold until a certain date | | Title: | ATAT-2 bound K40Q MEC-12/MEC-7 microtubule | | Authors: | Lam, W.H., Yu, D., Zhai, Y., Ti, S. | | Deposition date: | 2024-02-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8yaj | | Status: | HOLD -- hold until a certain date | | Title: | ATAT-2 bound MEC-12/MEC-7 microtubule without acetyl-CoA | | Authors: | Lam, W.H., Yu, D., Zhai, Y., Ti, S. | | Deposition date: | 2024-02-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8yar | | Status: | HOLD -- hold until a certain date | | Title: | ATAT-2 bound K40R MEC-12/MEC-7 microtubule | | Authors: | Lam, W.H., Yu, D., Zhai, Y., Ti, S. | | Deposition date: | 2024-02-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8yaq | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of cellodextrin phosphorylase from Clostridium thermocellum with cellodextrin ligands | | Authors: | Kuga, T., Sunagawa, N., Igarashi, K. | | Deposition date: | 2024-02-09 | | Release date: | 2025-02-09 |
|
| PDBID: | 8yb4 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-11 | | Release date: | 2025-02-11 |
|
| PDBID: | 9fo7 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-06-11 | | Release date: | 2024-08-06 |
|
| PDBID: | 8qkv | | Status: | HOLD -- hold until a certain date | | Title: | SWR1-nucleosome complex in configuration 2 | | Authors: | Jalal, A.S.B., Wigley, D.B. | | Deposition date: | 2023-09-18 | | Release date: | 2024-09-18 |
|
| PDBID: | 9fp0 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-06-12 | | Release date: | 2024-08-07 |
|
| PDBID: | 8qmc | | Status: | HOLD -- hold until a certain date | | Title: | High resolution structure of the Streptococcus pneumoniae topoisomerase IV-complex with the V-site 18mer dsDNA and novel fluoroquinolone Delafloxacin | | Authors: | Najmudin, S., Pan, X.S., Wang, B., Chayen, N.E., Fisher, L.M., Sanderson, M.R. | | Deposition date: | 2023-09-21 | | Release date: | 2024-09-21 |
|
| PDBID: | 9fpc | | Status: | HOLD -- hold until a certain date | | Title: | Architectural insights into the corrin and metal binding sites of CobN cobaltochelatase | | Authors: | Pickersgill, R.W. | | Deposition date: | 2024-06-13 | | Release date: | 2024-12-13 | | Sequence: | >Entity 1
DSRAVPTPAAWELGKKSAELLITRYTQDHGEWPTSFGLTAWGTSNMRTGGDDIAQALALIGVQPVWDMASRRVTGYEIVPPAKLARPRVDVTLRISGFFRDAFPEQIALFDKAVRAVGALDEDVEDNPIAARMKAEQARLVAGGADPQTAERRAGYRVFGSKPGAYGAGLQALIDENGWAGRNDLAEAWLVWGGYAYGAGEEGQAERGLLEERLRSVQAVVQNQDNREHDLLDSDDYYQFEGGMAATVESLTGAMPSVYHNDHSRPEKPVIRALEEELSRVVRGRAANPKWIAGVMRHGYKGAAEIAATVDYLFAFAATTGKVGNHHFEAVYQAYIADRAVHDFMAEKNPAALAETAAKLNEAIERGFWTPRSNSARFELENLS
|
|
| PDBID: | 8qof | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-28 | | Release date: | 2024-09-28 |
|
| PDBID: | 8qog | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of the yeast SPT-Orm2-Monomer complex | | Authors: | Schaefer, J., Koerner, C., Moeller, A., Froehlich, F. | | Deposition date: | 2023-09-28 | | Release date: | 2024-09-28 |
|
| PDBID: | 8qol | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-29 | | Release date: | 2024-09-29 |
|
