| PDBID: | 8kbd | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 9f7e | | Status: | HOLD -- hold until a certain date | | Title: | CtdA Canavanine tRNA-editing deacetylase from Pseudomonas canavaninivorans | | Authors: | Tabagari, N., Mayans, O. | | Deposition date: | 2024-05-03 | | Release date: | 2025-05-03 |
|
| PDBID: | 8kbe | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8kbi | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8kbj | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8kbk | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8xro | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of 5-Aminoimidazole Ribonucleotide (AIR) Synthetase from Pyrococcus horikoshii with ATP | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2024-01-07 | | Release date: | 2025-01-07 |
|
| PDBID: | 8kbl | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8kbm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-04 |
|
| PDBID: | 8xs6 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with Tapinarof | | Authors: | Diao, X., Shang, Q., Wu, D. | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8xs7 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with FICZ | | Authors: | Diao, X., Shang, Q., Wu, D. | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8xs8 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with Benzo[a]pyrene | | Authors: | Diao, X., Shang, Q., Wu, D. | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8xsv | | Status: | HOLD -- hold until a certain date | | Title: | crystal structure of PPAT mutant P8A | | Authors: | Yin, H.S. | | Deposition date: | 2024-01-10 | | Release date: | 2025-01-10 |
|
| PDBID: | 8kc9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-06 |
|
| PDBID: | 8xtt | | Status: | HOLD -- hold until a certain date | | Title: | Nuclear receptor Nor1 ligand binding domain | | Authors: | Yoo, J.Y., Yoon, H.S. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
KSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
|
|
| PDBID: | 8xto | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 head domain segment L18-G38 in solution | | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
LGGGSVRFGPGVAFRAPSIHG
|
|
| PDBID: | 8xtn | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 head domain segment Y6-G38 in solution | | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
YRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHG
|
|
| PDBID: | 8kcv | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of UDA01-CAAMDDFQL | | Authors: | Tang, Z., Zhang, N. | | Deposition date: | 2023-08-08 | | Release date: | 2024-08-08 |
|
| PDBID: | 8xs9 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with beta-Naphthoflavone | | Authors: | Diao, X., Shang, Q., Wu, D. | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8kcy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2025-02-08 |
|
| PDBID: | 9f0b | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-15 | | Release date: | 2025-04-15 |
|
| PDBID: | 8xsb | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with Indirubin | | Authors: | Diao, X., Shang, Q., Wu, D. | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 8xsa | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with Indigo | | Authors: | Diao, X., Shang, Q., Wu, D. | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
| PDBID: | 9ert | | Status: | HOLD -- hold until a certain date | | Title: | Mouse CNPase catalytic domain with nano body 5E | | Authors: | Markusson, S., Raasakka, A., Opazo, F., Kursula, P. | | Deposition date: | 2024-03-25 | | Release date: | 2025-03-25 |
|
| PDBID: | 8xst | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-09 | | Release date: | 2025-01-09 |
|
