PDBID: | 8kbd | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-04 | Release date: | 2024-08-04 |
|
PDBID: | 9f7e | Status: | HOLD -- hold until a certain date | Title: | CtdA Canavanine tRNA-editing deacetylase from Pseudomonas canavaninivorans | Authors: | Tabagari, N., Mayans, O. | Deposition date: | 2024-05-03 | Release date: | 2025-05-03 |
|
PDBID: | 8kbe | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-04 | Release date: | 2024-08-04 |
|
PDBID: | 8kbi | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-04 | Release date: | 2024-08-04 |
|
PDBID: | 8kbj | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-04 | Release date: | 2024-08-04 |
|
PDBID: | 8kbk | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-04 | Release date: | 2024-08-04 |
|
PDBID: | 8xro | Status: | HOLD -- hold until a certain date | Title: | Crystal Structure of 5-Aminoimidazole Ribonucleotide (AIR) Synthetase from Pyrococcus horikoshii with ATP | Authors: | Chen, Y.H., Chen, C.J. | Deposition date: | 2024-01-07 | Release date: | 2025-01-07 |
|
PDBID: | 8kbl | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-04 | Release date: | 2024-08-04 |
|
PDBID: | 8kbm | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-04 | Release date: | 2024-08-04 |
|
PDBID: | 8xs6 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with Tapinarof | Authors: | Diao, X., Shang, Q., Wu, D. | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 8xs7 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with FICZ | Authors: | Diao, X., Shang, Q., Wu, D. | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 8xs8 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with Benzo[a]pyrene | Authors: | Diao, X., Shang, Q., Wu, D. | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 8xsv | Status: | HOLD -- hold until a certain date | Title: | crystal structure of PPAT mutant P8A | Authors: | Yin, H.S. | Deposition date: | 2024-01-10 | Release date: | 2025-01-10 |
|
PDBID: | 8kc9 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-06 | Release date: | 2025-02-06 |
|
PDBID: | 8xtt | Status: | HOLD -- hold until a certain date | Title: | Nuclear receptor Nor1 ligand binding domain | Authors: | Yoo, J.Y., Yoon, H.S. | Deposition date: | 2024-01-11 | Release date: | 2025-01-11 | Sequence: | >Entity 1 KSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
|
|
PDBID: | 8xto | Status: | HOLD -- hold until a certain date | Title: | Human Keratin 19 head domain segment L18-G38 in solution | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | Deposition date: | 2024-01-11 | Release date: | 2025-01-11 | Sequence: | >Entity 1 LGGGSVRFGPGVAFRAPSIHG
|
|
PDBID: | 8xtn | Status: | HOLD -- hold until a certain date | Title: | Human Keratin 19 head domain segment Y6-G38 in solution | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | Deposition date: | 2024-01-11 | Release date: | 2025-01-11 | Sequence: | >Entity 1 YRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHG
|
|
PDBID: | 8kcv | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of UDA01-CAAMDDFQL | Authors: | Tang, Z., Zhang, N. | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8xs9 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with beta-Naphthoflavone | Authors: | Diao, X., Shang, Q., Wu, D. | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 8kcy | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2025-02-08 |
|
PDBID: | 9f0b | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-04-15 | Release date: | 2025-04-15 |
|
PDBID: | 8xsb | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with Indirubin | Authors: | Diao, X., Shang, Q., Wu, D. | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 8xsa | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the DNA-bound AHR-ARNT heterodimer in complex with Indigo | Authors: | Diao, X., Shang, Q., Wu, D. | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|
PDBID: | 9ert | Status: | HOLD -- hold until a certain date | Title: | Mouse CNPase catalytic domain with nano body 5E | Authors: | Markusson, S., Raasakka, A., Opazo, F., Kursula, P. | Deposition date: | 2024-03-25 | Release date: | 2025-03-25 |
|
PDBID: | 8xst | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-09 | Release date: | 2025-01-09 |
|