| PDBID: | 8iyy | | Status: | HOLD -- hold until a certain date | | Title: | Single excitation and two emissions pH sensor protein(SITE-pHorin)_pH7.0 | | Authors: | Li, S.A., Kang, J.S. | | Deposition date: | 2023-04-06 | | Release date: | 2024-07-06 |
|
| PDBID: | 8iyz | | Status: | HOLD -- hold until a certain date | | Title: | mTurquoise2 S65T | | Authors: | Kang, J.S., Li, S.A. | | Deposition date: | 2023-04-06 | | Release date: | 2024-07-06 |
|
| PDBID: | 8iz0 | | Status: | HOLD -- hold until a certain date | | Title: | mTurquoise2 W66Y | | Authors: | Li, S.A., Kang, J.S. | | Deposition date: | 2023-04-06 | | Release date: | 2024-07-06 |
|
| PDBID: | 8iz2 | | Status: | HOLD -- hold until a certain date | | Title: | Single excitation and two emissions pH sensor protein (SITE-pHorin)_C203E_pH8.0 | | Authors: | Kang, J.S., Li, S.A. | | Deposition date: | 2023-04-06 | | Release date: | 2024-07-06 |
|
| PDBID: | 8iyv | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of trypsin-famotidine complex at 2.10 Angstroms resolution | | Authors: | Ahmad, M.S., Kalam, N., Akbar, Z., Rasheed, S., Choudhary, M.I. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 8izi | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-04-07 | | Release date: | 2024-10-07 |
|
| PDBID: | 9bf7 | | Status: | HOLD -- hold until a certain date | | Title: | SARS-CoV-2 Papain-like Protease (PLpro) C111S Untagged Crystal Structure | | Authors: | Al-Homoudi, A.I., Brunzelle, J.S., Gavande, N., Kovari, L.C. | | Deposition date: | 2024-04-17 | | Release date: | 2025-04-17 |
|
| PDBID: | 8izs | | Status: | HOLD -- hold until a certain date | | Title: | Structure of a triple-helix region of human collagen type XVII | | Authors: | Zhu, Y., Yang, X., Sun, F. | | Deposition date: | 2023-04-07 | | Release date: | 2024-10-07 |
|
| PDBID: | 9bsr | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-B-136B | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 9bst | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor CID8009_5647 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 8w2a | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-20 | | Release date: | 2025-02-20 |
|
| PDBID: | 8vxb | | Status: | HOLD -- hold until a certain date | | Title: | Structure of ANT(6)-Ib from Campylobacter fetus subsp fetus complexed with hydrated streptomycin | | Authors: | Nalam, P., Cook, P., Smith, B. | | Deposition date: | 2024-02-04 | | Release date: | 2025-02-04 | | Sequence: | >Entity 1
MKMRTEKQIYDTILNFAKADDRIRVVTLEGSRTNINIIPDDFQDYDITFFVTDMQSFINSDEWLNVFGERLIMQKPEDMELFPKEEKGYSYLMLFWDGVKIDLTLLPLEVLDEYFTWDKLVKLLLDKDNRVTNIPVPTDEDYYIEHPTARSFDDCCNEFWNTVTYVVKGLCRKEILFAIDHLNNIVRMELLRMISWKVGIEQGYSFSLGKNYKFLERYISPELWKKILATYNMGSYTEMWKSLELCMGIFRMVSKEVAQCLNYLYPDYDKNISNYVIRQKEKYQRDPNSSSVDKLAAALEHHHHHH
|
|
| PDBID: | 8vxo | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of modified JEV virus E protein dimer | | Authors: | Galkin, A., Pozharski, E., Li, Y. | | Deposition date: | 2024-02-05 | | Release date: | 2025-02-05 |
|
| PDBID: | 8j47 | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM Structure of 40-Residue Arctic (E22G) Beta-Amyloid Fibril Derived by Co-Analysis with Solid-State NMR | E22G Abeta40 | | Authors: | Tehrani, M.J., Matsuda, I., Yamagata, A., Matsunaga, T., Sato, M., Toyooka, K., Shirouzu, M., Ishii, Y., Kodama, Y., McElheny, D., Kobayashi, N. | | Deposition date: | 2023-04-19 | | Release date: | 2024-10-23 |
|
| PDBID: | 8j4n | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-04-20 | | Release date: | 2024-10-20 |
|
| PDBID: | 8j4o | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of the Acinetobacter baumannii LysR family regulator AceR effector-binding domain with Spermidine | | Authors: | Ma, J.M., Ge, H.H. | | Deposition date: | 2023-04-20 | | Release date: | 2024-10-20 |
|
| PDBID: | 8j4v | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-04-21 | | Release date: | 2024-10-30 |
|
| PDBID: | 8j4w | | Status: | HOLD -- hold until a certain date | | Title: | Structure of Mycobacterium thermoresistibile NrdI(reduced) determined at 1.1 angstrom resolution | | Authors: | Yadav, L.R., Mande, S.C. | | Deposition date: | 2023-04-21 | | Release date: | 2024-10-30 |
|
| PDBID: | 8j4x | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-04-21 | | Release date: | 2024-10-30 |
|
| PDBID: | 8j8m | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-05-02 | | Release date: | 2024-07-01 |
|
| PDBID: | 8j8l | | Status: | HOLD -- hold until a certain date | | Title: | Overall structure of the LAT1-4F2hc bound with L-dopa | | Authors: | Yan, R.H., Li, Y.N., Shi, T.H. | | Deposition date: | 2023-05-02 | | Release date: | 2024-07-01 |
|
| PDBID: | 8jam | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Omicron BA.1 RBD in complex with W328-6H2 (local refinement) | | Authors: | Nan, X.Y., Li, Y.J. | | Deposition date: | 2023-05-06 | | Release date: | 2024-11-06 |
|
| PDBID: | 8jap | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of SARS-CoV-2 WT RBD in complex with W328-6H2 (local refinement) | | Authors: | Nan, X.Y., Li, Y.J. | | Deposition date: | 2023-05-06 | | Release date: | 2024-11-06 |
|
| PDBID: | 8jc1 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of Pectocin M1 from Pectobacterium carotovorum | | Authors: | Jantarit, N., Kurisu, G., Tanaka, H. | | Deposition date: | 2023-05-10 | | Release date: | 2024-11-10 |
|
| PDBID: | 8je5 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-05-15 | | Release date: | 2024-11-15 |
|
