PDBID: | 8psw | Status: | HPUB -- hold until publication | Title: | ERK2 covalently bound to RU67 cyclohexenone based inhibitor | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | Deposition date: | 2023-07-13 |
|
PDBID: | 8psy | Status: | HPUB -- hold until publication | Title: | ERK2 covelently bound to RU68 cyclohexenone based inhibitor | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | Deposition date: | 2023-07-13 |
|
PDBID: | 8pst | Status: | HPUB -- hold until publication | Title: | ERK2 covelently bound to RU60 cyclohexenone based inhibitor | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | Deposition date: | 2023-07-13 |
|
PDBID: | 8pt0 | Status: | HPUB -- hold until publication | Title: | ERK2 covelently bound to RU75 cyclohexenone based inhibitor | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | Deposition date: | 2023-07-13 |
|
PDBID: | 8pt1 | Status: | HPUB -- hold until publication | Title: | ERK2 covelently bound to RU76 cyclohexenone based inhibitor | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | Deposition date: | 2023-07-13 |
|
PDBID: | 8pt3 | Status: | HPUB -- hold until publication | Title: | ERK2 covelently bound to RU77 cyclohexenone based inhibitor | Authors: | Sok, P., Poti, A., Remenyi, A. | Deposition date: | 2023-07-13 |
|
PDBID: | 8pt5 | Status: | HPUB -- hold until publication | Title: | ERK2 covelently bound to RU187 cyclohexenone based inhibitor | Authors: | Sok, P., Poti, A., Remenyi, A. | Deposition date: | 2023-07-13 |
|
PDBID: | 8psr | Status: | HPUB -- hold until publication | Title: | ERK2 covalently bound to SynthRevD-12-opt artificial peptide | Authors: | Sok, P., Poti, A., Gogl, G., Remenyi, A. | Deposition date: | 2023-07-13 |
|
PDBID: | 8pt9 | Status: | HPUB -- hold until publication | Title: | JNK1 covalently bound to BD838 cyclohexenone based inhibitor | Authors: | Sok, P., Poti, A., Remenyi, A. | Deposition date: | 2023-07-13 |
|
PDBID: | 8pta | Status: | HPUB -- hold until publication | Title: | JNK1 covalently bound to BD837 cyclohexenone based inhibitor | Authors: | Sok, P., Poti, A., Remenyi, A. | Deposition date: | 2023-07-13 |
|
PDBID: | 8k2u | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-07-13 | Release date: | 2025-01-13 |
|
PDBID: | 8pt8 | Status: | HPUB -- hold until publication | Title: | JNK1 covalently bound to RU135 cyclohexenone based inhibitor | Authors: | Sok, P., Poti, A., Remenyi, A. | Deposition date: | 2023-07-13 |
|
PDBID: | 8tgu | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of BG505 SOSIP trimer purified via Galanthus nivalis lectin chromatography | Authors: | Parsons, R.J., Pothula, K., Acharya, P. | Deposition date: | 2023-07-13 |
|
PDBID: | 8tgw | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of 1059 SOSIP trimer purified via Galanthus nivalis lectin chromatography | Authors: | Pothula, K., Parsons, R.J., Acharya, P. | Deposition date: | 2023-07-13 |
|
PDBID: | 8tgv | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-13 |
|
PDBID: | 8tgx | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2023-07-13 |
|
PDBID: | 8tgs | Status: | AUTH -- processed, waiting for author review and approval | Title: | The crystal structure of the post-reactive state of UDP-sugar pyrophosphorylase from Leishmania major in complex with product UDP-Glucose and by-product analog VO4 (orthovanadate) | Authors: | Prakash, O., Fuehring, J.I., Baruch, P., Routier, F.H., Fedorov, R. | Deposition date: | 2023-07-13 |
|
PDBID: | 8tgz | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-13 |
|
PDBID: | 8ptt | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-14 |
|
PDBID: | 8k30 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-14 | Release date: | 2025-01-14 |
|
PDBID: | 8k2z | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-14 | Release date: | 2025-01-14 |
|
PDBID: | 8ptd | Status: | HPUB -- hold until publication | Title: | The surface-exposed lipo-protein of BtuG1 in complex with cyanocobalamin. | Authors: | Whittaker, J., Felices Martinez, J.M., Guskov, A., Slotboom, D.J. | Deposition date: | 2023-07-14 |
|
PDBID: | 8pts | Status: | HPUB -- hold until publication | Title: | human GUK1 in complex with compound AT8001 | Authors: | Zimberger, C., Canard, B., Ferron, F. | Deposition date: | 2023-07-14 | Sequence: | >Entity 1 MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
|
|
PDBID: | 8ptf | Status: | HPUB -- hold until publication | Title: | The surface-exposed lipo-protein of BtuG2 in complex with cyanocobalamin. | Authors: | Whittaker, J., Felices Martinez, J.M., Guskov, A., Slotboom, D.J. | Deposition date: | 2023-07-14 |
|
PDBID: | 8ptv | Status: | HPUB -- hold until publication | Title: | IPNS variant N252Q in complex with Fe and ACV under anaerobic conditions | Authors: | Rabe, P., Schofield, C.J. | Deposition date: | 2023-07-15 |
|