| PDBID: | 8byr | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MoaB2 protein from Mycobacterium smegmatis | | Authors: | Narasimhan, S., Sanderova, H., Zidek, L., Krasny, L. | | Deposition date: | 2022-12-21 | | Release date: | 2024-06-21 |
|
| PDBID: | 8c1w | | Status: | HPUB -- hold until publication | | Title: | Tetrameric 5-HT3A receptor in Salipro (apo, asymmetric) | | Authors: | Introini, B., Kudryashev, M. | | Deposition date: | 2022-12-21 | | Release date: | 2024-06-21 |
|
| PDBID: | 8c20 | | Status: | HPUB -- hold until publication | | Title: | Tetrameric 5-HT3aR in Salipro (holo state, symmetric) | | Authors: | Introini, B., Kudryashev, M. | | Deposition date: | 2022-12-21 | | Release date: | 2024-06-21 |
|
| PDBID: | 8c21 | | Status: | HPUB -- hold until publication | | Title: | Tetrameric 5-HT3A receptor in Salipro (holo, asymmetric) | | Authors: | Introini, B., Kudryashev, M. | | Deposition date: | 2022-12-21 | | Release date: | 2024-06-21 |
|
| PDBID: | 8c1z | | Status: | HPUB -- hold until publication | | Title: | Tetrameric 5-HT3aR in Salipro (apo state, symmetric) | | Authors: | Introini, B., Kudryashev, M. | | Deposition date: | 2022-12-21 | | Release date: | 2024-06-21 |
|
| PDBID: | 8c45 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-01-01 | | Release date: | 2024-07-01 |
|
| PDBID: | 8hx0 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of MsDps2 from Mycobacterium smegmatis | | Authors: | Garg, P., Dutta, S. | | Deposition date: | 2023-01-03 | | Release date: | 2024-07-03 |
|
| PDBID: | 8hwz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-01-03 | | Release date: | 2024-07-03 |
|
| PDBID: | 8hx1 | | Status: | HOLD -- hold until a certain date | | Title: | Focused cryo-EM map of MsDps2 from MsDps2-DNA complex of Mycobacterium smegmatis | | Authors: | Dutta, S., Garg, P. | | Deposition date: | 2023-01-03 | | Release date: | 2024-07-03 |
|
| PDBID: | 8fpa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of a chimeric antibody (Fab) fragment bound to de-N-acetyl polysialic acid (dPSA) | | Authors: | Beernink, P.T., Agirre, J., Beernink, B.P., Moe, G.R. | | Deposition date: | 2023-01-04 | | Release date: | 2024-07-19 |
|
| PDBID: | 8c4x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-01-05 | | Release date: | 2024-07-05 |
|
| PDBID: | 8c4z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-01-05 | | Release date: | 2024-07-05 |
|
| PDBID: | 8fpo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-01-05 | | Release date: | 2024-07-10 |
|
| PDBID: | 8fpq | | Status: | HOLD -- hold until a certain date | | Title: | PCSK9 in complex with an inhibitor | | Authors: | Xu, M., Chopra, R. | | Deposition date: | 2023-01-05 | | Release date: | 2024-07-10 |
|
| PDBID: | 8fri | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST in complex with AW4, short soaking | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-01-07 | | Release date: | 2024-07-07 |
|
| PDBID: | 8hyr | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of human KARS apo | | Authors: | Zhang, X., Wang, Y. | | Deposition date: | 2023-01-07 | | Release date: | 2024-07-07 | | Sequence: | >Entity 1
MSVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKELEHHHHHH
|
|
| PDBID: | 8frq | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST in complex with T14, long soaking | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-01-08 | | Release date: | 2024-07-08 |
|
| PDBID: | 8frv | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST in complex with T17, short soaking | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-01-09 | | Release date: | 2024-07-09 |
|
| PDBID: | 8fse | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain | | Authors: | Wu, J., Gao, T. | | Deposition date: | 2023-01-09 | | Release date: | 2024-06-30 |
|
| PDBID: | 8hzv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-01-09 | | Release date: | 2024-07-09 |
|
| PDBID: | 8fsk | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST in complex with T18, short soaking | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-01-10 | | Release date: | 2024-07-10 |
|
| PDBID: | 8fso | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of integrin beta-6 tail bound to the FERM-folded talin head domain | | Authors: | Wu, J., Gao, T. | | Deposition date: | 2023-01-10 | | Release date: | 2024-06-30 |
|
| PDBID: | 8hzy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-01-10 | | Release date: | 2024-07-10 |
|
| PDBID: | 8c61 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-01-11 | | Release date: | 2024-07-17 |
|
| PDBID: | 8ft9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-01-11 | | Release date: | 2024-08-31 |
|
