+
Open data
-
Basic information
| Entry | Database: PDB / ID: 9n73 | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Title | SSU processome maturation and disassembly, State G | |||||||||||||||
Components |
| |||||||||||||||
Keywords | RIBOSOME / SSU processome / ribosome assembly / RNA folding / RNA-protein interactions | |||||||||||||||
| Function / homology | Function and homology information18S rRNA (adenine1779-N6/adenine1780-N6)-dimethyltransferase / 18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase activity / nuclear polyadenylation-dependent antisense transcript catabolic process / nuclear polyadenylation-dependent snoRNA catabolic process / nuclear polyadenylation-dependent snRNA catabolic process / tRNA wobble cytosine modification / regulation of ribosomal protein gene transcription by RNA polymerase II / U1 snRNA 3'-end processing / nuclear polyadenylation-dependent mRNA catabolic process / nuclear polyadenylation-dependent CUT catabolic process ...18S rRNA (adenine1779-N6/adenine1780-N6)-dimethyltransferase / 18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase activity / nuclear polyadenylation-dependent antisense transcript catabolic process / nuclear polyadenylation-dependent snoRNA catabolic process / nuclear polyadenylation-dependent snRNA catabolic process / tRNA wobble cytosine modification / regulation of ribosomal protein gene transcription by RNA polymerase II / U1 snRNA 3'-end processing / nuclear polyadenylation-dependent mRNA catabolic process / nuclear polyadenylation-dependent CUT catabolic process / U5 snRNA 3'-end processing / tRNA cytidine N4-acetyltransferase activity / rRNA acetylation involved in maturation of SSU-rRNA / 18S rRNA cytidine N-acetyltransferase activity / box H/ACA snoRNA binding / TRAMP-dependent tRNA surveillance pathway / RNA fragment catabolic process / tRNA acetylation / exosome (RNase complex) / rRNA small subunit pseudouridine methyltransferase Nep1 / CURI complex / UTP-C complex / 90S preribosome assembly / U4 snRNA 3'-end processing / nuclear polyadenylation-dependent rRNA catabolic process / poly(A)-dependent snoRNA 3'-end processing / endonucleolytic cleavage in ITS1 upstream of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) / Noc4p-Nop14p complex / nuclear exosome (RNase complex) / t-UTP complex / nuclear microtubule / Pwp2p-containing subcomplex of 90S preribosome / box C/D sno(s)RNA binding / Mpp10 complex / exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) / rRNA (pseudouridine) methyltransferase activity / rRNA modification / rRNA (adenine-N6,N6-)-dimethyltransferase activity / snoRNA guided rRNA 2'-O-methylation / septum digestion after cytokinesis / histone H2AQ104 methyltransferase activity / snRNA binding / tRNA re-export from nucleus / histone mRNA catabolic process / rRNA 2'-O-methylation / nuclear mRNA surveillance / box C/D sno(s)RNA 3'-end processing / regulation of rRNA processing / rRNA methyltransferase activity / endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) / maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, LSU-rRNA,5S) / endonucleolytic cleavage of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) / post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery / regulation of transcription by RNA polymerase I / SUMOylation of RNA binding proteins / endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) / rDNA heterochromatin / RNA folding chaperone / box C/D methylation guide snoRNP complex / tRNA export from nucleus / single-stranded telomeric DNA binding / O-methyltransferase activity / rRNA primary transcript binding / sno(s)RNA-containing ribonucleoprotein complex / small nuclear ribonucleoprotein complex / U4 snRNA binding / rRNA base methylation / protein localization to nucleolus / positive regulation of rRNA processing / mTORC1-mediated signalling / Protein hydroxylation / U4/U6 snRNP / RNA catabolic process / rRNA methylation / U3 snoRNA binding / regulation of telomere maintenance / U4 snRNP / ascospore wall assembly / Formation of the ternary complex, and subsequently, the 43S complex / Translation initiation complex formation / Ribosomal scanning and start codon recognition / mRNA modification / poly(A)+ mRNA export from nucleus / positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay / establishment of cell polarity / preribosome, small subunit precursor / snoRNA binding / poly(U) RNA binding / precatalytic spliceosome / Major pathway of rRNA processing in the nucleolus and cytosol / PELO:HBS1L and ABCE1 dissociate a ribosome on a non-stop mRNA / SRP-dependent cotranslational protein targeting to membrane / GTP hydrolysis and joining of the 60S ribosomal subunit / Formation of a pool of free 40S subunits / spliceosomal complex assembly / Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC) / positive regulation of transcription by RNA polymerase I / Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC) / L13a-mediated translational silencing of Ceruloplasmin expression / nucleolar large rRNA transcription by RNA polymerase I Similarity search - Function | |||||||||||||||
| Biological species | ![]() | |||||||||||||||
| Method | ELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 5.96 Å | |||||||||||||||
Authors | Buzovetsky, O. / Klinge, S. | |||||||||||||||
| Funding support | United States, 2items
| |||||||||||||||
Citation | Journal: Nature / Year: 2025Title: Helicase-mediated mechanism of SSU processome maturation and disassembly. Authors: Olga Buzovetsky / Sebastian Klinge / ![]() Abstract: Eukaryotic ribosomal small subunit (SSU) assembly requires the SSU processome, a nucleolar precursor containing the RNA chaperone U3 small nucleolar RNA (snoRNA). The underlying molecular mechanisms ...Eukaryotic ribosomal small subunit (SSU) assembly requires the SSU processome, a nucleolar precursor containing the RNA chaperone U3 small nucleolar RNA (snoRNA). The underlying molecular mechanisms of SSU processome maturation, remodelling, disassembly and RNA quality control, and the transitions between states remain unknown owing to a paucity of intermediates. Here we report 16 native SSU processome structures alongside genetic data, revealing how two helicases, the Mtr4-exosome and Dhr1, are controlled for accurate and unidirectional ribosome biogenesis. Our data show how irreversible pre-ribosomal RNA degradation by the redundantly tethered RNA exosome couples the transformation of the SSU processome into a pre-40S particle, during which Utp14 can probe evolving surfaces, ultimately positioning and activating Dhr1 to unwind the U3 snoRNA and initiate nucleolar pre-40S release. This study highlights a paradigm for large dynamic RNA-protein complexes in which irreversible RNA degradation drives compositional changes and communicates these changes to govern enzyme activity while maintaining overall quality control. | |||||||||||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 9n73.cif.gz | 4.5 MB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb9n73.ent.gz | Display | PDB format | |
| PDBx/mmJSON format | 9n73.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/n7/9n73 ftp://data.pdbj.org/pub/pdb/validation_reports/n7/9n73 | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 49083MC ![]() 9n6vC ![]() 9n6wC ![]() 9n6xC ![]() 9n6yC ![]() 9n6zC ![]() 9n70C ![]() 9n72C ![]() 9n74C ![]() 9n75C ![]() 9n76C ![]() 9n77C ![]() 9n78C ![]() 9n79C ![]() 9n7aC ![]() 9n7bC C: citing same article ( M: map data used to model this data |
|---|---|
| Similar structure data | Similarity search - Function & homology F&H Search |
-
Links
-
Assembly
| Deposited unit | ![]()
|
|---|---|
| 1 |
|
-
Components
+RNA chain , 3 types, 3 molecules L0L1L2
+40S ribosomal protein ... , 18 types, 18 molecules L3L4L5L6L7L8L9LCLDLELFLGNFNGNPNQOHSR
+Protein , 19 types, 23 molecules LHLOLULXLYNBNDNLNMNNNSNVOAOUSCSDSESFSHSJSKSWSZ
+U3 small nucleolar RNA-associated protein ... , 17 types, 17 molecules LILJLKLLLMLNLPLQLRLSLTLWNANHSPSSSY
+Ribosome biogenesis protein ... , 2 types, 2 molecules LVSI
+U3 small nucleolar ribonucleoprotein protein ... , 3 types, 3 molecules LZNCSM
+Ribosomal RNA-processing protein ... , 2 types, 2 molecules NISG
+Nucleolar protein ... , 2 types, 2 molecules SASB
+RRNA-processing protein ... , 2 types, 2 molecules SLSQ
+Nucleolar complex protein ... , 2 types, 2 molecules STSU
+Details
-Experimental details
-Experiment
| Experiment | Method: ELECTRON MICROSCOPY |
|---|---|
| EM experiment | Aggregation state: PARTICLE / 3D reconstruction method: single particle reconstruction |
-
Sample preparation
| Component | Name: SSU processome maturation and disassembly, State G / Type: COMPLEX / Entity ID: all / Source: NATURAL | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Source (natural) | Organism: ![]() | ||||||||||||||||||||||||||||
| Buffer solution | pH: 7.5 | ||||||||||||||||||||||||||||
| Buffer component |
| ||||||||||||||||||||||||||||
| Specimen | Embedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES | ||||||||||||||||||||||||||||
| Vitrification | Cryogen name: ETHANE |
-
Electron microscopy imaging
| Experimental equipment | ![]() Model: Titan Krios / Image courtesy: FEI Company |
|---|---|
| Microscopy | Model: TFS KRIOS |
| Electron gun | Electron source: FIELD EMISSION GUN / Accelerating voltage: 300 kV / Illumination mode: OTHER |
| Electron lens | Mode: BRIGHT FIELD / Nominal defocus max: 25000 nm / Nominal defocus min: 1000 nm |
| Image recording | Electron dose: 60 e/Å2 / Film or detector model: GATAN K3 (6k x 4k) |
-
Processing
| CTF correction | Type: PHASE FLIPPING AND AMPLITUDE CORRECTION |
|---|---|
| 3D reconstruction | Resolution: 5.96 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 4987 / Symmetry type: POINT |
Movie
Controller
About Yorodumi






United States, 2items
Citation





































































































































PDBj







































FIELD EMISSION GUN