[English] 日本語
Yorodumi- PDB-9fia: SSU(body) structure derived from the SSU sample of the mitoriboso... -
+
Open data
-
Basic information
| Entry | Database: PDB / ID: 9fia | ||||||
|---|---|---|---|---|---|---|---|
| Title | SSU(body) structure derived from the SSU sample of the mitoribosome from T. gondii. | ||||||
Components |
| ||||||
Keywords | RIBOSOME / Complex / translation / rRNA | ||||||
| Function / homology | Function and homology informationhydro-lyase activity / mitochondrial small ribosomal subunit / mitochondrial translation / isomerase activity / fatty acid metabolic process / small ribosomal subunit / small ribosomal subunit rRNA binding / ribosome / translation / structural constituent of ribosome ...hydro-lyase activity / mitochondrial small ribosomal subunit / mitochondrial translation / isomerase activity / fatty acid metabolic process / small ribosomal subunit / small ribosomal subunit rRNA binding / ribosome / translation / structural constituent of ribosome / ribonucleoprotein complex / mitochondrion / DNA binding / RNA binding / cytoplasm Similarity search - Function | ||||||
| Biological species | ![]() | ||||||
| Method | ELECTRON MICROSCOPY / single particle reconstruction / cryo EM / Resolution: 3.29 Å | ||||||
Authors | Rocha, R.E.O. / Barua, S. / Boissier, F. / Nguyen, T.T. / Hashem, Y. | ||||||
| Funding support | European Union, 1items
| ||||||
Citation | Journal: Nat Commun / Year: 2024Title: Apicomplexan mitoribosome from highly fragmented rRNAs to a functional machine. Authors: Chaoyue Wang / Sari Kassem / Rafael Eduardo Oliveira Rocha / Pei Sun / Tan-Trung Nguyen / Joachim Kloehn / Xianyong Liu / Lorenzo Brusini / Alessandro Bonavoglia / Sramona Barua / Fanny ...Authors: Chaoyue Wang / Sari Kassem / Rafael Eduardo Oliveira Rocha / Pei Sun / Tan-Trung Nguyen / Joachim Kloehn / Xianyong Liu / Lorenzo Brusini / Alessandro Bonavoglia / Sramona Barua / Fanny Boissier / Mayara Lucia Del Cistia / Hongjuan Peng / Xinming Tang / Fujie Xie / Zixuan Wang / Oscar Vadas / Xun Suo / Yaser Hashem / Dominique Soldati-Favre / Yonggen Jia / ![]() Abstract: The phylum Apicomplexa comprises eukaryotic parasites that cause fatal diseases affecting millions of people and animals worldwide. Their mitochondrial genomes have been significantly reduced, ...The phylum Apicomplexa comprises eukaryotic parasites that cause fatal diseases affecting millions of people and animals worldwide. Their mitochondrial genomes have been significantly reduced, leaving only three protein-coding genes and highly fragmented mitoribosomal rRNAs, raising challenging questions about mitoribosome composition, assembly and structure. Our study reveals how Toxoplasma gondii assembles over 40 mt-rRNA fragments using exclusively nuclear-encoded mitoribosomal proteins and three lineage-specific families of RNA-binding proteins. Among these are four proteins from the Apetala2/Ethylene Response Factor (AP2/ERF) family, originally known as transcription factors in plants and Apicomplexa, now repurposed as essential mitoribosome components. Cryo-EM analysis of the mitoribosome structure demonstrates how these AP2 proteins function as RNA binders to maintain mitoribosome integrity. The mitoribosome is also decorated with members of lineage-specific RNA-binding proteins belonging to RAP (RNA-binding domain abundant in Apicomplexa) proteins and HPR (heptatricopeptide repeat) families, highlighting the unique adaptations of these parasites. Solving the molecular puzzle of apicomplexan mitoribosome could inform the development of therapeutic strategies targeting organellar translation. | ||||||
| History |
|
-
Structure visualization
| Structure viewer | Molecule: Molmil Jmol/JSmol |
|---|
-
Downloads & links
-
Download
| PDBx/mmCIF format | 9fia.cif.gz | 1.9 MB | Display | PDBx/mmCIF format |
|---|---|---|---|---|
| PDB format | pdb9fia.ent.gz | Display | PDB format | |
| PDBx/mmJSON format | 9fia.json.gz | Tree view | PDBx/mmJSON format | |
| Others | Other downloads |
-Validation report
| Arichive directory | https://data.pdbj.org/pub/pdb/validation_reports/fi/9fia ftp://data.pdbj.org/pub/pdb/validation_reports/fi/9fia | HTTPS FTP |
|---|
-Related structure data
| Related structure data | ![]() 50470MC ![]() 9fi8C ![]() 9g6kC M: map data used to model this data C: citing same article ( |
|---|---|
| Similar structure data | Similarity search - Function & homology F&H Search |
-
Links
-
Assembly
| Deposited unit | ![]()
|
|---|---|
| 1 |
|
-
Components
-Mitochondrial ribosomal protein, ... , 11 types, 11 molecules B0B3BABCBEBFBKBTBWBiBk
| #1: Protein | Mass: 75001.570 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
|---|---|
| #4: Protein | Mass: 41612.438 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
| #11: Protein | Mass: 102582.984 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
| #13: Protein | Mass: 44677.082 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
| #15: Protein | Mass: 116977.320 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
| #16: Protein | Mass: 34463.469 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
| #21: Protein | Mass: 59459.469 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
| #27: Protein | Mass: 30802.619 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
| #30: Protein | Mass: 59978.730 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
| #39: Protein | Mass: 28704.660 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
| #40: Protein | Mass: 51592.316 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
-Unidentified ... , 12 types, 15 molecules B1B7B8BjBIBNBXBJBPBUBYBaBbBdBe
| #2: Protein/peptide | Mass: 1464.797 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Details: unidentified peptide / Source: (natural) ![]() | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| #8: Protein/peptide | Mass: 1039.273 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Details: Unidentified peptide 2 / Source: (natural) ![]() | ||||||||||||||||||
| #9: Protein/peptide | Mass: 1805.216 Da / Num. of mol.: 2 / Source method: isolated from a natural source / Source: (natural) ![]() #19: Protein/peptide | Mass: 1124.378 Da / Num. of mol.: 3 / Source method: isolated from a natural source / Source: (natural) ![]() #20: Protein/peptide | | Mass: 2230.741 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() #24: Protein/peptide | | Mass: 4017.944 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() #28: Protein/peptide | | Mass: 1209.482 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() #31: Protein/peptide | | Mass: 954.168 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() #32: Protein/peptide | | Mass: 869.063 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() #33: Protein/peptide | | Mass: 698.854 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() #35: Protein/peptide | | Mass: 2826.475 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() #36: Protein/peptide | | Mass: 1549.902 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
-Ribosomal protein ... , 2 types, 2 molecules B2B5
| #3: Protein | Mass: 84465.203 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
|---|---|
| #6: Protein | Mass: 43464.711 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
-Protein , 9 types, 9 molecules B4B6B9BBBDBQBVBcHS
| #5: Protein | Mass: 16112.727 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
|---|---|
| #7: Protein | Mass: 19272.775 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
| #10: Protein | Mass: 25359.863 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
| #12: Protein | Mass: 168566.484 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
| #14: Protein | Mass: 74729.930 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
| #25: Protein | Mass: 75927.227 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
| #29: Protein | Mass: 67147.445 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
| #34: Protein | Mass: 80344.000 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
| #43: Protein | Mass: 27403.414 Da / Num. of mol.: 1 / Source method: isolated from a natural source Details: Correct sequence: ...Details: Correct sequence: MAPFPRGIVKPRSAKVRAILNLSVEQRQPNPLRAPRKSLLDPPPCVAPLEKGNPKLDRQFDTLNRSITGFRKYKAPHTTAPRVVRDRDETNFHEMLGKFRFDLQGSFKENGDMLRDSLLQVGRDLFLVGWVKCRSRFATGHIQGDVHALSYMRRYLEKHVDESVSSVRFYEENFGMPLLEYERLSAVNDFRAPGKKQQHALRAAEKNKAKKLEQESLRHAQELERFYEENCIRNY Source: (natural) ![]() |
-Ribosomal protein, ... , 3 types, 3 molecules BGBSBg
| #17: Protein | Mass: 18266.240 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
|---|---|
| #26: Protein | Mass: 28104.543 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
| #37: Protein | Mass: 34172.914 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
-Putative ribosomal protein ... , 2 types, 2 molecules BHBL
| #18: Protein | Mass: 14858.699 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
|---|---|
| #22: Protein | Mass: 14084.434 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
-Putative 30S ribosomal protein ... , 2 types, 2 molecules BOBh
| #23: Protein | Mass: 44807.918 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
|---|---|
| #38: Protein | Mass: 19450.664 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
-30S ribosomal protein ... , 2 types, 2 molecules BlHJ
| #41: Protein | Mass: 66517.188 Da / Num. of mol.: 1 / Source method: isolated from a natural source / Source: (natural) ![]() |
|---|---|
| #42: Protein | Mass: 127333.422 Da / Num. of mol.: 1 / Source method: isolated from a natural source Details: Right sequence (uniprot ID = S8F5G8): ...Details: Right sequence (uniprot ID = S8F5G8): MRCPLAPRRQRRLPRDSSSSVSLFLPHRGSLSLSSAFSPSFRRSPCPRSSPCLASSVPPSRLFSSASPNDSRLALKKPLSPSFSSPFAFSRYTRDPELRHLTSTSRVQAPLPLRRCAAPVASLASSPCLSSSRASSASLSPCSLASLGSRSSPFCGGSRRGGERPPCERRASAGCGAAANSFSSAPRPSRLSPSSPFFPSGLGCSSSPAHRARVAGPRLPLRSAFVALFPGQPTRTLCFPAASSALSFSAQPSPPTASASSFQSPRRLHNSHQARVLRRRHVYRDKHLDHVPTERARQLAEQRSAFELPRGTGEPLQGGSRFPGGVMAPHLRVKLEKEKFLRDCMREQENLAALFTETEKETLLGRRGDSRESHEEEPATREAEKQTSEGGKSDEAGKDGGKQEDKQGAAPFGRKLQELESFVGSALRTYRLLRPHALPFYKEDSLLSMQSKLNEATLKHSPLVHDLVELKKRNLSVPSDLLPPDFNALQFSLPVVSARGFLLALSAAANSVAEDLEFLCRRLSVPNLPHPTHPFRLKLLLDALFESFKLRKDPHYAHDWAQRNWPRLQAAMPEPLSELSADSVGLWLKAHLERVIENQRGRHADGRGRLLAQKFPLKSDEEDLYSLADDFIFDHEIVDEQFCDERLSQFPIDKAGELFRRVADFFGLTKGPQPAVNDAVVAQFQNLVYTLDEIGLSNWMKMDTREIEEFLPEGDPPSFAASQQDLDAARLLLKAAARGKANLLDFEALDPYKLLHGFDFKTVQEELATLPPNPFLTDADIDELFDITTAAVSMNQSEVAPSASLRNFKAKFGRTPLEALLDSEEKFLTSAGPVDWLKDEDENGEAFVSWRWKRPAQTVYDAEKGMFVREREGVDPLIKLHELRQTLLSVSRMMSMNKQGRVYYFRAIVAVGNGRGLFGIGIAFGPSPKEARSNAALAAIQNLDHIDFDVGRTLTTPVHGSEYSAHVKIVPRPLGKGLKSNLRYLPLLYLMGIDNCRVSFYGPSASARWFTRAKALKRALEQLQSRRTLANATGQKYDLLVAPGEHWMHWPDRWFRPISTEYARMLERIKKKRPPSYRRGFRAAIDEVIPEEIRPEFTPYTWKSPLQKWAEELKRKRLTSHNVYETEVFLHPPAQSSSPS Source: (natural) ![]() |
+RNA chain , 23 types, 23 molecules b1b2b3b4bAbDbEbGbHbIbJbKbLbNbObPbQbRbSbTbUbVbY
-Details
| Has protein modification | N |
|---|
-Experimental details
-Experiment
| Experiment | Method: ELECTRON MICROSCOPY |
|---|---|
| EM experiment | Aggregation state: PARTICLE / 3D reconstruction method: single particle reconstruction |
-
Sample preparation
| Component | Name: LSU structure derived from the LSU sample of the mitoribosome from T. gondii. Type: RIBOSOME / Entity ID: all / Source: NATURAL |
|---|---|
| Molecular weight | Value: 4 MDa / Experimental value: YES |
| Source (natural) | Organism: ![]() |
| Buffer solution | pH: 7.5 |
| Specimen | Embedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES |
| Specimen support | Grid material: COPPER / Grid type: Quantifoil R2/2 |
| Vitrification | Instrument: FEI VITROBOT MARK IV / Cryogen name: ETHANE / Humidity: 100 % / Chamber temperature: 277 K / Details: Blotting force 5, blotting time 2.5 seconds. |
-
Electron microscopy imaging
| Experimental equipment | ![]() Model: Talos Arctica / Image courtesy: FEI Company |
|---|---|
| Microscopy | Model: FEI TALOS ARCTICA |
| Electron gun | Electron source: FIELD EMISSION GUN / Accelerating voltage: 200 kV / Illumination mode: FLOOD BEAM |
| Electron lens | Mode: BRIGHT FIELD / Nominal magnification: 59000 X / Nominal defocus max: 2500 nm / Nominal defocus min: 500 nm / Cs: 2.7 mm / C2 aperture diameter: 30 µm / Alignment procedure: COMA FREE |
| Specimen holder | Cryogen: NITROGEN / Specimen holder model: FEI TITAN KRIOS AUTOGRID HOLDER / Temperature (max): 95 K / Temperature (min): 90 K |
| Image recording | Average exposure time: 6 sec. / Electron dose: 50 e/Å2 / Detector mode: COUNTING / Film or detector model: GATAN K2 SUMMIT (4k x 4k) / Num. of grids imaged: 1 / Num. of real images: 9524 |
| Image scans | Sampling size: 6.35 µm / Width: 4096 / Height: 4096 / Movie frames/image: 40 / Used frames/image: 1-40 |
-
Processing
| EM software |
| |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| CTF correction | Type: PHASE FLIPPING AND AMPLITUDE CORRECTION | |||||||||||||||||||||||||||||||||||
| Particle selection | Num. of particles selected: 280177 | |||||||||||||||||||||||||||||||||||
| 3D reconstruction | Resolution: 3.29 Å / Resolution method: FSC 0.143 CUT-OFF / Num. of particles: 22169 / Algorithm: BACK PROJECTION / Num. of class averages: 1 / Symmetry type: POINT | |||||||||||||||||||||||||||||||||||
| Atomic model building | Protocol: AB INITIO MODEL / Space: REAL |
Movie
Controller
About Yorodumi





Citation







PDBj































FIELD EMISSION GUN