[English] 日本語
![](img/lk-miru.gif)
- PDB-7qrf: Structure of the dimeric complex between precursor membrane ectod... -
+
Open data
-
Basic information
Entry | Database: PDB / ID: 7qrf | ||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Title | Structure of the dimeric complex between precursor membrane ectodomain (prM) and envelope protein ectodomain (E) from tick-borne encephalitis virus | ||||||||||||
![]() |
| ||||||||||||
![]() | VIRAL PROTEIN / class II fusion envelope protein / precursor membrane protein / chaperone / flavivirus maturation / trans-golgi acid pH | ||||||||||||
Function / homology | ![]() flavivirin / symbiont-mediated suppression of host JAK-STAT cascade via inhibition of STAT2 activity / symbiont-mediated suppression of host JAK-STAT cascade via inhibition of STAT1 activity / double-stranded RNA binding / viral capsid / nucleoside-triphosphate phosphatase / mRNA (guanine-N7)-methyltransferase / methyltransferase cap1 / clathrin-dependent endocytosis of virus by host cell / mRNA (nucleoside-2'-O-)-methyltransferase activity ...flavivirin / symbiont-mediated suppression of host JAK-STAT cascade via inhibition of STAT2 activity / symbiont-mediated suppression of host JAK-STAT cascade via inhibition of STAT1 activity / double-stranded RNA binding / viral capsid / nucleoside-triphosphate phosphatase / mRNA (guanine-N7)-methyltransferase / methyltransferase cap1 / clathrin-dependent endocytosis of virus by host cell / mRNA (nucleoside-2'-O-)-methyltransferase activity / mRNA 5'-cap (guanine-N7-)-methyltransferase activity / RNA helicase activity / host cell perinuclear region of cytoplasm / host cell endoplasmic reticulum membrane / protein dimerization activity / symbiont-mediated suppression of host type I interferon-mediated signaling pathway / RNA helicase / induction by virus of host autophagy / RNA-directed RNA polymerase / viral RNA genome replication / serine-type endopeptidase activity / RNA-dependent RNA polymerase activity / virus-mediated perturbation of host defense response / fusion of virus membrane with host endosome membrane / viral envelope / host cell nucleus / virion attachment to host cell / structural molecule activity / virion membrane / ATP hydrolysis activity / proteolysis / extracellular region / ATP binding / membrane / metal ion binding Similarity search - Function | ||||||||||||
Biological species | ![]() | ||||||||||||
Method | ![]() ![]() ![]() | ||||||||||||
![]() | Vaney, M.C. / Rouvinski, A. / Rey, F.A. | ||||||||||||
Funding support | ![]()
| ||||||||||||
![]() | ![]() Title: Evolution and activation mechanism of the flavivirus class II membrane-fusion machinery. Authors: Vaney, M.C. / Dellarole, M. / Duquerroy, S. / Medits, I. / Tsouchnikas, G. / Rouvinski, A. / England, P. / Stiasny, K. / Heinz, F.X. / Rey, F.A. #1: ![]() Title: The envelope glycoprotein from tick-borne encephalitis virus at 2 A resolution. Authors: Rey, F.A. / Heinz, F.X. / Mandl, C. / Kunz, C. / Harrison, S.C. | ||||||||||||
History |
|
-
Structure visualization
Structure viewer | Molecule: ![]() ![]() |
---|
-
Downloads & links
-
Download
PDBx/mmCIF format | ![]() | 205.5 KB | Display | ![]() |
---|---|---|---|---|
PDB format | ![]() | 161.1 KB | Display | ![]() |
PDBx/mmJSON format | ![]() | Tree view | ![]() | |
Others | ![]() |
-Validation report
Summary document | ![]() | 700.3 KB | Display | ![]() |
---|---|---|---|---|
Full document | ![]() | 703.7 KB | Display | |
Data in XML | ![]() | 18.9 KB | Display | |
Data in CIF | ![]() | 25.9 KB | Display | |
Arichive directory | ![]() ![]() | HTTPS FTP |
-Related structure data
Related structure data | ![]() 7qreC ![]() 7qrgC ![]() 1svbS ![]() 3c5xS C: citing same article ( S: Starting model for refinement |
---|---|
Similar structure data | Similarity search - Function & homology ![]() |
-
Links
-
Assembly
Deposited unit | ![]()
| ||||||||
---|---|---|---|---|---|---|---|---|---|
1 | ![]()
| ||||||||
Unit cell |
| ||||||||
Components on special symmetry positions |
|
-
Components
-Protein , 2 types, 2 molecules AD
#1: Protein | Mass: 47867.855 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Details: The N-terminal end of E (Molecule 1) is linked to the C-terminal of ectodomain prM (Molecule 3) by a linker of 14 residues (GGGGENLYFQGGGG). This linker of 14 residues is only described in ...Details: The N-terminal end of E (Molecule 1) is linked to the C-terminal of ectodomain prM (Molecule 3) by a linker of 14 residues (GGGGENLYFQGGGG). This linker of 14 residues is only described in the sequence of E (Molecule 1) at its N-terminal. For purification, at the C-terminal of E it is added an enterokinase site with a dstrep-tag sequence : (GPFEDDDDKAGWSHPQFEKGGGSGGGSGGGSWSHPQFEK). Source: (gene. exp.) ![]() Strain: Neudoerfl / Plasmid: PT389 / Cell (production host): SCHNEIDER 2 / Production host: ![]() ![]() |
---|---|
#3: Protein | Mass: 15290.941 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Details: The C-terminal end of prM (Molecule 3) is linked to the N-terminal of E (Molecule 1) by a linker of 14 residues (GGGGENLYFQGGGG). This linker is described in the sequence of E (Molecule 1). ...Details: The C-terminal end of prM (Molecule 3) is linked to the N-terminal of E (Molecule 1) by a linker of 14 residues (GGGGENLYFQGGGG). This linker is described in the sequence of E (Molecule 1). The furin site is deleted from one amino acid (Arginine). Intact furin site : ...RTRRSVL... Mutated furin site : ...RTRSVL... Source: (gene. exp.) ![]() Strain: Neudoerfl / Plasmid: PT389 / Cell (production host): SCHNEIDER 2 / Production host: ![]() ![]() |
-Protein/peptide , 1 types, 1 molecules C
#2: Protein/peptide | Mass: 443.539 Da / Num. of mol.: 1 Source method: isolated from a genetically manipulated source Details: This peptide should be part of the M ectodomain but we were unable to attribute the true sequence. Source: (gene. exp.) ![]() Strain: NEUDOERFL / Plasmid: PT389 / Cell (production host): SCHNEIDER 2 / Production host: ![]() ![]() |
---|
-Non-polymers , 4 types, 84 molecules ![](data/chem/img/SO4.gif)
![](data/chem/img/PE4.gif)
![](data/chem/img/EDO.gif)
![](data/chem/img/HOH.gif)
![](data/chem/img/PE4.gif)
![](data/chem/img/EDO.gif)
![](data/chem/img/HOH.gif)
#4: Chemical | ChemComp-SO4 / | ||
---|---|---|---|
#5: Chemical | ChemComp-PE4 / | ||
#6: Chemical | ChemComp-EDO / #7: Water | ChemComp-HOH / | |
-Details
Has ligand of interest | N |
---|
-Experimental details
-Experiment
Experiment | Method: ![]() |
---|
-
Sample preparation
Crystal | Density Matthews: 2.97 Å3/Da / Density % sol: 58.63 % |
---|---|
Crystal grow | Temperature: 293 K / Method: vapor diffusion / pH: 3.5 Details: 0.2M Li(SO4), 0.1M Na citrate pH 3.5, 28% (v/v) PEG 400 |
-Data collection
Diffraction | Mean temperature: 100 K / Serial crystal experiment: N |
---|---|
Diffraction source | Source: ![]() ![]() ![]() |
Detector | Type: DECTRIS PILATUS 6M / Detector: PIXEL / Date: Feb 14, 2014 |
Radiation | Protocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray |
Radiation wavelength | Wavelength: 0.97934 Å / Relative weight: 1 |
Reflection | Resolution: 2.28→49 Å / Num. obs: 28985 / % possible obs: 95 % / Redundancy: 19.5 % / CC1/2: 0.998 / Rmerge(I) obs: 0.096 / Rpim(I) all: 0.023 / Rrim(I) all: 0.099 / Net I/σ(I): 19.8 |
Reflection shell | Resolution: 2.28→2.435 Å / Rmerge(I) obs: 2.623 / Num. unique obs: 1449 / CC1/2: 0.323 / Rpim(I) all: 0.891 / Rrim(I) all: 2.699 |
-
Processing
Software |
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Refinement | Method to determine structure: ![]() Starting model: 1SVB, 3C5X Resolution: 2.28→28.42 Å / Cor.coef. Fo:Fc: 0.96 / Cor.coef. Fo:Fc free: 0.939 / SU R Cruickshank DPI: 0.222 / Cross valid method: THROUGHOUT / σ(F): 0 / SU R Blow DPI: 0.217 / SU Rfree Blow DPI: 0.18 / SU Rfree Cruickshank DPI: 0.183 Details: The BUSTER refinement was done against the STARANISO corrected intensity from anisotropy. This is the reason why, in the last shell of resolution, the completness is 7% while the working ...Details: The BUSTER refinement was done against the STARANISO corrected intensity from anisotropy. This is the reason why, in the last shell of resolution, the completness is 7% while the working Rfactor is higher than the free Rfactor. All the refinement stastitics introduced here are from the STARANISO statistics output.
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Displacement parameters | Biso max: 178.25 Å2 / Biso mean: 80.83 Å2 / Biso min: 44.08 Å2
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Refine analyze | Luzzati coordinate error obs: 0.3 Å | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Refinement step | Cycle: final / Resolution: 2.28→28.42 Å
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Refine LS restraints |
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
LS refinement shell | Resolution: 2.28→2.36 Å / Rfactor Rfree error: 0 / Total num. of bins used: 15
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Refinement TLS params. | Method: refined / Refine-ID: X-RAY DIFFRACTION
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Refinement TLS group |
|