[English] 日本語
Yorodumi
- PDB-7bvx: Crystal structure of C-terminal fragment of pilus adhesin SpaC fr... -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 7bvx
TitleCrystal structure of C-terminal fragment of pilus adhesin SpaC from Lactobacillus rhamnosus GG-Iodide soaked
ComponentsPilus assembly protein
KeywordsCELL ADHESION / Pilus adhesin / Tip pilin / SpaCBA pilus / sortase / Lactobacillus rhamnosus GG / pili / fimbria / Probiotics / SpaC / surface protein
Function / homology
Function and homology information


Prealbumin-like fold domain / Prealbumin-like fold domain / von Willebrand factor type A domain / von Willebrand factor (vWF) type A domain / VWFA domain profile. / von Willebrand factor, type A / von Willebrand factor A-like domain superfamily / Immunoglobulin-like fold
Similarity search - Domain/homology
IODIDE ION / Pilus assembly protein
Similarity search - Component
Biological speciesLactobacillus rhamnosus (bacteria)
MethodX-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 3.36 Å
AuthorsKant, A. / Palva, A. / von Ossowski, I. / Krishnan, V.
Funding support India, 1items
OrganizationGrant numberCountry
Department of Biotechnology (DBT, India)BT/PR5891/BRB/10/1098/2012 India
CitationJournal: J.Struct.Biol. / Year: 2020
Title: Crystal structure of lactobacillar SpaC reveals an atypical five-domain pilus tip adhesin: Exposing its substrate-binding and assembly in SpaCBA pili.
Authors: Kant, A. / Palva, A. / von Ossowski, I. / Krishnan, V.
History
DepositionApr 12, 2020Deposition site: PDBJ / Processing site: PDBJ
Revision 1.0Jul 29, 2020Provider: repository / Type: Initial release
Revision 1.1Aug 19, 2020Group: Database references / Category: citation / Item: _citation.journal_volume
Revision 1.2Aug 26, 2020Group: Structure summary / Category: audit_author / Item: _audit_author.name
Revision 1.3Sep 9, 2020Group: Structure summary / Category: audit_author / Item: _audit_author.name
Revision 1.4Sep 15, 2021Group: Advisory / Database references / Derived calculations
Category: database_2 / pdbx_unobs_or_zero_occ_atoms ...database_2 / pdbx_unobs_or_zero_occ_atoms / pdbx_validate_close_contact / struct_conn
Item: _database_2.pdbx_DOI / _database_2.pdbx_database_accession
Revision 1.5Nov 29, 2023Group: Data collection / Refinement description
Category: chem_comp_atom / chem_comp_bond / pdbx_initial_refinement_model

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
A: Pilus assembly protein
hetero molecules


Theoretical massNumber of molelcules
Total (without water)32,2797
Polymers31,5171
Non-polymers7616
Water00
1


  • Idetical with deposited unit
  • defined by author&software
  • Evidence: gel filtration
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Buried area140 Å2
ΔGint-1 kcal/mol
Surface area13760 Å2
MethodPISA
Unit cell
Length a, b, c (Å)60.045, 114.919, 122.240
Angle α, β, γ (deg.)90.00, 90.00, 90.00
Int Tables number23
Space group name H-MI222

-
Components

#1: Protein Pilus assembly protein


Mass: 31517.412 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Details: MGSSHHHHHHSSGLVPRGSHMTNQQYGFQFQKKTTDGTDLSADQLKAMQFNLTQYSDNSF QQASKTNAITSTDLQALAPGYYGIQEAAAPTGYQLDGTTYLFQLTSDGQWQYHGTKDNVT SGSVINGQQTLNPVGDKSDDFTVTGDHQQILTLTKYDEPKPSMTLRVIKQDNQSQYLAGA ...Details: MGSSHHHHHHSSGLVPRGSHMTNQQYGFQFQKKTTDGTDLSADQLKAMQFNLTQYSDNSF QQASKTNAITSTDLQALAPGYYGIQEAAAPTGYQLDGTTYLFQLTSDGQWQYHGTKDNVT SGSVINGQQTLNPVGDKSDDFTVTGDHQQILTLTKYDEPKPSMTLRVIKQDNQSQYLAGA AFTLQPSAGEAETITSSATSEGQAFATKLVADGTYTMSETKAPDGYQSNPAKIAIQVATT GKEATVTIDGEALKPGESKNGYTLAIDGSTITLQAINQPLAILPLEHHHHHH
Source: (gene. exp.) Lactobacillus rhamnosus (bacteria) / Gene: CCE29_04955 / Plasmid: pET28a / Production host: Escherichia coli BL21(DE3) (bacteria) / Strain (production host): pLysS / References: UniProt: A0A1Y0DVK9
#2: Chemical
ChemComp-IOD / IODIDE ION


Mass: 126.904 Da / Num. of mol.: 6 / Source method: obtained synthetically / Formula: I / Feature type: SUBJECT OF INVESTIGATION
Has ligand of interestY

-
Experimental details

-
Experiment

ExperimentMethod: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

CrystalDensity Matthews: 3.51 Å3/Da / Density % sol: 65.02 %
Crystal growTemperature: 295 K / Method: vapor diffusion / Details: 2M Lithium Sulfate

-
Data collection

DiffractionMean temperature: 100 K / Serial crystal experiment: N
Diffraction sourceSource: SYNCHROTRON / Site: ELETTRA / Beamline: 11.2C / Wavelength: 1.4231 Å
DetectorType: DECTRIS PILATUS 6M / Detector: PIXEL / Date: Feb 21, 2019
RadiationProtocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelengthWavelength: 1.4231 Å / Relative weight: 1
ReflectionResolution: 3.35→57.53 Å / Num. obs: 6345 / % possible obs: 100 % / Redundancy: 12.6 % / CC1/2: 0.99 / Rmerge(I) obs: 0.055 / Rpim(I) all: 0.016 / Net I/σ(I): 34.7
Reflection shellResolution: 3.35→3.41 Å / Redundancy: 13.4 % / Rmerge(I) obs: 0.86 / Mean I/σ(I) obs: 2.3 / Num. unique obs: 324 / CC1/2: 0.88 / Rpim(I) all: 0.24 / % possible all: 100

-
Processing

Software
NameVersionClassification
REFMAC5.8.0258refinement
XDSdata reduction
autoPROCdata scaling
PHASERphasing
RefinementMethod to determine structure: MOLECULAR REPLACEMENT
Starting model: 6M3Y
Resolution: 3.36→57.46 Å / Cor.coef. Fo:Fc: 0.874 / Cor.coef. Fo:Fc free: 0.856 / SU B: 44.209 / SU ML: 0.44 / Cross valid method: THROUGHOUT / ESU R Free: 0.624 / Details: HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS
RfactorNum. reflection% reflectionSelection details
Rfree0.34573 295 4.6 %RANDOM
Rwork0.30479 ---
obs0.30677 6050 99.94 %-
Solvent computationIon probe radii: 0.8 Å / Shrinkage radii: 0.8 Å / VDW probe radii: 1.2 Å
Displacement parametersBiso mean: 145.844 Å2
Baniso -1Baniso -2Baniso -3
1--9.31 Å2-0 Å20 Å2
2--3.38 Å2-0 Å2
3---5.93 Å2
Refinement stepCycle: 1 / Resolution: 3.36→57.46 Å
ProteinNucleic acidLigandSolventTotal
Num. atoms1674 0 7 0 1681
Refine LS restraints
Refine-IDTypeDev idealDev ideal targetNumber
X-RAY DIFFRACTIONr_bond_refined_d0.010.0121716
X-RAY DIFFRACTIONr_bond_other_d0.0020.0181338
X-RAY DIFFRACTIONr_angle_refined_deg1.931.6552357
X-RAY DIFFRACTIONr_angle_other_deg1.6241.5673079
X-RAY DIFFRACTIONr_dihedral_angle_1_deg9.2725259
X-RAY DIFFRACTIONr_dihedral_angle_2_deg43.01125.76952
X-RAY DIFFRACTIONr_dihedral_angle_3_deg22.74515174
X-RAY DIFFRACTIONr_dihedral_angle_4_deg11.852151
X-RAY DIFFRACTIONr_chiral_restr0.0750.2271
X-RAY DIFFRACTIONr_gen_planes_refined0.0080.022088
X-RAY DIFFRACTIONr_gen_planes_other0.0020.02327
X-RAY DIFFRACTIONr_nbd_refined
X-RAY DIFFRACTIONr_nbd_other
X-RAY DIFFRACTIONr_nbtor_refined
X-RAY DIFFRACTIONr_nbtor_other
X-RAY DIFFRACTIONr_xyhbond_nbd_refined
X-RAY DIFFRACTIONr_xyhbond_nbd_other
X-RAY DIFFRACTIONr_metal_ion_refined
X-RAY DIFFRACTIONr_metal_ion_other
X-RAY DIFFRACTIONr_symmetry_vdw_refined
X-RAY DIFFRACTIONr_symmetry_vdw_other
X-RAY DIFFRACTIONr_symmetry_hbond_refined
X-RAY DIFFRACTIONr_symmetry_hbond_other
X-RAY DIFFRACTIONr_symmetry_metal_ion_refined
X-RAY DIFFRACTIONr_symmetry_metal_ion_other
X-RAY DIFFRACTIONr_mcbond_it7.71610.6541039
X-RAY DIFFRACTIONr_mcbond_other7.71410.6541038
X-RAY DIFFRACTIONr_mcangle_it11.83915.9771297
X-RAY DIFFRACTIONr_mcangle_other11.83615.9761298
X-RAY DIFFRACTIONr_scbond_it7.51910.442677
X-RAY DIFFRACTIONr_scbond_other7.51310.441678
X-RAY DIFFRACTIONr_scangle_it
X-RAY DIFFRACTIONr_scangle_other11.27115.6311061
X-RAY DIFFRACTIONr_long_range_B_refined17.4466697
X-RAY DIFFRACTIONr_long_range_B_other17.4476696
X-RAY DIFFRACTIONr_rigid_bond_restr
X-RAY DIFFRACTIONr_sphericity_free
X-RAY DIFFRACTIONr_sphericity_bonded
LS refinement shellResolution: 3.36→3.444 Å
RfactorNum. reflection% reflection
Rfree0.37 29 -
Rwork0.29 438 -
obs--100 %
Refinement TLS params.

Method: refined / Refine-ID: X-RAY DIFFRACTION

IDL112)L122)L132)L222)L232)L332)S11 (Å °)S12 (Å °)S13 (Å °)S21 (Å °)S22 (Å °)S23 (Å °)S31 (Å °)S32 (Å °)S33 (Å °)T112)T122)T132)T222)T232)T332)Origin x (Å)Origin y (Å)Origin z (Å)
16.25980.4956-2.1043.36431.14246.49740.15540.3658-0.0126-0.943-0.43480.35340.0831-0.85360.27950.41530.1093-0.13950.1476-0.0760.0706-12.2195-1.1877-16.3809
24.355-2.2683-1.99953.5720.7392.5066-0.071-0.2860.24230.34880.0244-0.565-0.7676-0.1590.04670.85590.1156-0.02030.394-0.19260.21877.5311-28.1925-46.5978
Refinement TLS group
IDRefine-IDRefine TLS-IDAuth asym-IDAuth seq-ID
1X-RAY DIFFRACTION1A597 - 732
2X-RAY DIFFRACTION2A733 - 856

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbjlc1.pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more