Evidence: isothermal titration calorimetry, A chain and B chain forms a complex with the molar ratio of 1:1
Type
Name
Symmetry operation
Number
identity operation
1_555
x,y,z
1
Buried area
2480 Å2
ΔGint
-14 kcal/mol
Surface area
13980 Å2
Method
PISA
Unit cell
Length a, b, c (Å)
75.124, 121.063, 37.768
Angle α, β, γ (deg.)
90.000, 90.000, 90.000
Int Tables number
18
Space group name H-M
P21212
-
Components
#1: Protein
chimeraATG2AandWIPI3 / WIPI-3 / WD repeat-containing protein 45-like / WDR45-like protein / WD repeat-containing protein ...WIPI-3 / WD repeat-containing protein 45-like / WDR45-like protein / WD repeat-containing protein 45B / WIPI49-like protein
Mass: 38459.828 Da / Num. of mol.: 2 / Mutation: Deletion of 75-80 and Deletion of 264-280 Source method: isolated from a genetically manipulated source Details: The sequence provided here is chimeric. We fused ATG2A (1374-1404) to the N-terminal of WIPI3. And we also deleted two loops in WIPI3 (Loop1: 75-80; loop2: 264-281). The first four residues ...Details: The sequence provided here is chimeric. We fused ATG2A (1374-1404) to the N-terminal of WIPI3. And we also deleted two loops in WIPI3 (Loop1: 75-80; loop2: 264-281). The first four residues (GPGS) is the expression tag. Residues form 5 to 35 (PRDGEPVVTQLHPGPIVVRDGYFSRPIGSTD) is the fused ATG2A sequence (from 1374 to 1404). Residues from 36 to 37 (GS) is the linker. The rest part is form WIPI3. Source: (gene. exp.) Homo sapiens (human) / Gene: ATG2A, KIAA0404, WDR45B, WDR45L, WIPI3 / Plasmid: pET32a / Production host: Escherichia coli (E. coli) / References: UniProt: Q2TAZ0, UniProt: Q5MNZ6
Mass: 18.015 Da / Num. of mol.: 18 / Source method: isolated from a natural source / Formula: H2O
-
Experimental details
-
Experiment
Experiment
Method: X-RAY DIFFRACTION / Number of used crystals: 1
-
Sample preparation
Crystal
Density Matthews: 2.44 Å3/Da / Density % sol: 48.01 % Description: Authors state that Sfcheck gives the Matthews coefficient about 2.44, Phenix.Xtriage gives 2.18.
In the structure databanks used in Yorodumi, some data are registered as the other names, "COVID-19 virus" and "2019-nCoV". Here are the details of the virus and the list of structure data.
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)
EMDB accession codes are about to change! (news from PDBe EMDB page)
The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
The EM Navigator/Yorodumi systems omit the EMD- prefix.
Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator
Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.
Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi