[English] 日本語
Yorodumi
- PDB-6klr: Crystal structure of human WIPI3 in complex with the WIR-peptide ... -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 6klr
TitleCrystal structure of human WIPI3 in complex with the WIR-peptide from ATG2A
Componentschimera ATG2A and WIPI3
KeywordsLIPID BINDING PROTEIN / MEMBRANE BOUND PROTEIN
Function / homology
Function and homology information


TSC1-TSC2 complex binding / phagophore / organelle membrane contact site / lipid transfer activity / glycophagy / nucleophagy / positive regulation of autophagosome assembly / phagophore assembly site membrane / protein localization to phagophore assembly site / autophagy of mitochondrion ...TSC1-TSC2 complex binding / phagophore / organelle membrane contact site / lipid transfer activity / glycophagy / nucleophagy / positive regulation of autophagosome assembly / phagophore assembly site membrane / protein localization to phagophore assembly site / autophagy of mitochondrion / piecemeal microautophagy of the nucleus / phosphatidylinositol-3-phosphate binding / pexophagy / phagophore assembly site / phosphatidylinositol-3,5-bisphosphate binding / reticulophagy / Macroautophagy / autophagosome assembly / protein-membrane adaptor activity / lipid droplet / positive regulation of autophagy / cellular response to starvation / protein-macromolecule adaptor activity / lysosome / endoplasmic reticulum membrane / cytosol
Similarity search - Function
Autophagy-related protein 2 / Autophagy-related protein 2 / : / PROPPIN / WD40 repeats / WD40 repeat / WD40-repeat-containing domain superfamily / WD40/YVTN repeat-like-containing domain superfamily
Similarity search - Domain/homology
Autophagy-related protein 2 homolog A / WD repeat domain phosphoinositide-interacting protein 3
Similarity search - Component
Biological speciesHomo sapiens (human)
MethodX-RAY DIFFRACTION / SYNCHROTRON / MOLECULAR REPLACEMENT / Resolution: 2.21 Å
AuthorsRen, J.Q. / Liang, R.B. / Feng, W.
CitationJournal: Nat Commun / Year: 2020
Title: Multi-site-mediated entwining of the linear WIR-motif around WIPI beta-propellers for autophagy.
Authors: Ren, J. / Liang, R. / Wang, W. / Zhang, D. / Yu, L. / Feng, W.
History
DepositionJul 30, 2019Deposition site: PDBJ / Processing site: PDBJ
Revision 1.0Apr 29, 2020Provider: repository / Type: Initial release
Revision 1.1Jun 17, 2020Group: Database references / Category: citation / citation_author
Item: _citation.country / _citation.journal_abbrev ..._citation.country / _citation.journal_abbrev / _citation.journal_id_CSD / _citation.journal_id_ISSN / _citation.journal_volume / _citation.page_first / _citation.page_last / _citation.pdbx_database_id_DOI / _citation.pdbx_database_id_PubMed / _citation.title / _citation.year / _citation_author.identifier_ORCID / _citation_author.name
Revision 1.2Nov 22, 2023Group: Data collection / Database references / Refinement description
Category: chem_comp_atom / chem_comp_bond ...chem_comp_atom / chem_comp_bond / database_2 / pdbx_initial_refinement_model
Item: _database_2.pdbx_DOI / _database_2.pdbx_database_accession

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
A: chimera ATG2A and WIPI3
B: chimera ATG2A and WIPI3


Theoretical massNumber of molelcules
Total (without water)76,9202
Polymers76,9202
Non-polymers00
Water32418
1


  • Idetical with deposited unit
  • defined by author&software
  • Evidence: isothermal titration calorimetry, A chain and B chain forms a complex with the molar ratio of 1:1
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Buried area2480 Å2
ΔGint-14 kcal/mol
Surface area13980 Å2
MethodPISA
Unit cell
Length a, b, c (Å)75.124, 121.063, 37.768
Angle α, β, γ (deg.)90.000, 90.000, 90.000
Int Tables number18
Space group name H-MP21212

-
Components

#1: Protein chimera ATG2A and WIPI3 / WIPI-3 / WD repeat-containing protein 45-like / WDR45-like protein / WD repeat-containing protein ...WIPI-3 / WD repeat-containing protein 45-like / WDR45-like protein / WD repeat-containing protein 45B / WIPI49-like protein


Mass: 38459.828 Da / Num. of mol.: 2 / Mutation: Deletion of 75-80 and Deletion of 264-280
Source method: isolated from a genetically manipulated source
Details: The sequence provided here is chimeric. We fused ATG2A (1374-1404) to the N-terminal of WIPI3. And we also deleted two loops in WIPI3 (Loop1: 75-80; loop2: 264-281). The first four residues ...Details: The sequence provided here is chimeric. We fused ATG2A (1374-1404) to the N-terminal of WIPI3. And we also deleted two loops in WIPI3 (Loop1: 75-80; loop2: 264-281). The first four residues (GPGS) is the expression tag. Residues form 5 to 35 (PRDGEPVVTQLHPGPIVVRDGYFSRPIGSTD) is the fused ATG2A sequence (from 1374 to 1404). Residues from 36 to 37 (GS) is the linker. The rest part is form WIPI3.
Source: (gene. exp.) Homo sapiens (human) / Gene: ATG2A, KIAA0404, WDR45B, WDR45L, WIPI3 / Plasmid: pET32a / Production host: Escherichia coli (E. coli) / References: UniProt: Q2TAZ0, UniProt: Q5MNZ6
#2: Water ChemComp-HOH / water


Mass: 18.015 Da / Num. of mol.: 18 / Source method: isolated from a natural source / Formula: H2O

-
Experimental details

-
Experiment

ExperimentMethod: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

CrystalDensity Matthews: 2.44 Å3/Da / Density % sol: 48.01 %
Description: Authors state that Sfcheck gives the Matthews coefficient about 2.44, Phenix.Xtriage gives 2.18.
Crystal growTemperature: 289 K / Method: vapor diffusion, sitting drop / Details: 0.1M Tirs-HCl, pH 8.5, 20% (v/v) Ethanol / PH range: 8.5

-
Data collection

DiffractionMean temperature: 100 K / Serial crystal experiment: N
Diffraction sourceSource: SYNCHROTRON / Site: SSRF / Beamline: BL19U1 / Wavelength: 0.97855 Å
DetectorType: DECTRIS PILATUS3 6M / Detector: PIXEL / Date: Jan 18, 2018
RadiationProtocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelengthWavelength: 0.97855 Å / Relative weight: 1
ReflectionResolution: 2.2→50 Å / Num. obs: 17842 / % possible obs: 99.3 % / Redundancy: 11.6 % / Biso Wilson estimate: 53.4 Å2 / CC1/2: 0.989 / Rmerge(I) obs: 0.093 / Rpim(I) all: 0.029 / Rrim(I) all: 0.102 / Χ2: 0.934 / Net I/av σ(I): 20.6 / Net I/σ(I): 23.1
Reflection shellResolution: 2.2→2.28 Å / Redundancy: 7.9 % / Rmerge(I) obs: 0.423 / Mean I/σ(I) obs: 3.2 / Num. unique obs: 1650 / CC1/2: 0.925 / CC star: 0.98 / Rpim(I) all: 0.149 / Rrim(I) all: 0.451 / Χ2: 0.745 / % possible all: 96.2

-
Processing

Software
NameVersionClassification
PHENIX1.17.1_3660refinement
PDB_EXTRACT3.25data extraction
HKL-2000data reduction
HKL-2000data scaling
PHASERphasing
RefinementMethod to determine structure: MOLECULAR REPLACEMENT
Starting model: 6IYY
Resolution: 2.21→24.52 Å / SU ML: 0.36 / Cross valid method: THROUGHOUT / σ(F): 1.35 / Phase error: 36.27
RfactorNum. reflection% reflectionSelection details
Rfree0.2553 864 4.9 %Random selection
Rwork0.2126 ---
obs0.2147 17638 98.38 %-
Solvent computationShrinkage radii: 0.9 Å / VDW probe radii: 1.11 Å
Displacement parametersBiso max: 184.12 Å2 / Biso min: 30 Å2
Refinement stepCycle: final / Resolution: 2.21→24.52 Å
ProteinNucleic acidLigandSolventTotal
Num. atoms2451 0 0 18 2469
Biso mean---67.47 -
Num. residues----319
LS refinement shell

Refine-ID: X-RAY DIFFRACTION / Rfactor Rfree error: 0 / Total num. of bins used: 6

Resolution (Å)Rfactor RfreeNum. reflection RfreeRfactor RworkNum. reflection RworkNum. reflection all% reflection obs (%)
2.21-2.350.42891520.35982606275895
2.35-2.530.34591520.29452737288999
2.53-2.780.30231320.24962788292099
2.78-3.190.3021350.244728262961100
3.19-4.010.26011340.216828592993100
4.01-24.520.21521590.1782958311798
Refinement TLS params.

Method: refined / Refine-ID: X-RAY DIFFRACTION

IDL112)L122)L132)L222)L232)L332)S11 (Å °)S12 (Å °)S13 (Å °)S21 (Å °)S22 (Å °)S23 (Å °)S31 (Å °)S32 (Å °)S33 (Å °)T112)T122)T132)T222)T232)T332)Origin x (Å)Origin y (Å)Origin z (Å)
15.91920.701-1.33233.73470.26051.643-0.22690.17180.8958-0.18970.26150.46650.1877-0.0879-0.0030.5061-0.0364-0.10490.49570.01760.486990.9591137.017846.244
21.3229-1.3322-0.52222.10930.16251.288-0.1205-0.3120.9828-0.1393-0.1951-1.11520.11750.3004-0.3450.62020.00890.07060.9183-0.20091.1166111.1411141.997346.1801
Refinement TLS group
IDRefine-IDRefine TLS-IDSelection detailsAuth asym-IDAuth seq-ID
1X-RAY DIFFRACTION1(chain 'A' and resid 9 through 311)A9 - 311
2X-RAY DIFFRACTION2(chain 'B' and resid 1378 through 1399)B1378 - 1399

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more