[English] 日本語
Yorodumi
- PDB-5wyj: Cryo-EM structure of the 90S small subunit pre-ribosome (Dhr1-dep... -

+
Open data


ID or keywords:

Loading...

no data

-
Basic information

Entry
Database: PDB / ID: 5wyj
TitleCryo-EM structure of the 90S small subunit pre-ribosome (Dhr1-depleted, Enp1-TAP, state 1)
DescriptorrRNA 2'-O-methyltransferase fibrillarin
13 kDa ribonucleoprotein-associated protein
Utp4
Utp5
Utp8
and more 26 items
KeywordsRIBOSOME / ribosome / 90S / pre-ribosome / protein-RNA complex
Specimen sourceSaccharomyces cerevisiae (strain atcc 204508 / s288c) / yeast / Baker's yeast /
MethodElectron microscopy (8.7 Å resolution / Particle / Single particle)
AuthorsYe, K. / Zhu, X. / Sun, Q.
CitationElife, 2017, 6

Elife, 2017, 6 Yorodumi Papers
Molecular architecture of the 90S small subunit pre-ribosome.
Qi Sun / Xing Zhu / Jia Qi / Weidong An / Pengfei Lan / Dan Tan / Rongchang Chen / Bing Wang / Sanduo Zheng / Cheng Zhang / Xining Chen / Wei Zhang / Jing Chen / Meng-Qiu Dong / Keqiong Ye

Validation Report
SummaryFull reportAbout validation report
DateDeposition: Jan 13, 2017 / Release: Mar 29, 2017
RevisionDateData content typeGroupProviderType
1.0Mar 29, 2017Structure modelrepositoryInitial release
1.1May 17, 2017Structure modelStructure summary

-
Structure visualization

Movie
  • Deposited structure unit
  • Imaged by Jmol
  • Download
3D viewer


View / / Stereo:
Center
Zoom
Scale
Slabnear <=> far

fix: /
Orientation
Orientation Rotation
Misc. /
Show/hide

Downloads & links

-
Assembly

Deposited unit
3A: U3 RNA
3B: rRNA 2'-O-methyltransferase fibrillarin
3C: rRNA 2'-O-methyltransferase fibrillarin
3D: Nucleolar protein 56
3E: Nucleolar protein 58
3F: Ribosomal RNA-processing protein 9
3G: 13 kDa ribonucleoprotein-associated protein
3H: 13 kDa ribonucleoprotein-associated protein
5A: 5ETS RNA
AA: Utp4
AB: Utp5
AC: Utp8
AD: Utp9
AE: U3 small nucleolar RNA-associated protein 10,Utp10
AF: Utp15
AG: Utp17
B1: Ribosome biogenesis protein BMS1
BA: Periodic tryptophan protein 2
BB: U3 small nucleolar RNA-associated protein 12
BC: U3 small nucleolar RNA-associated protein 13
BD: U3 small nucleolar RNA-associated protein 18
BE: U3 small nucleolar RNA-associated protein 21
CA: Ribosomal RNA-processing protein 7
CB: U3 small nucleolar RNA-associated protein 22
E1: Ribosomal RNA small subunit methyltransferase NEP1
E2: Ribosomal RNA small subunit methyltransferase NEP1
E3: Essential nuclear protein 1
E4: Enp2
K1: KRR1 small subunit processome component
MA: U3 small nucleolar ribonucleoprotein protein IMP3
MB: U3 small nucleolar ribonucleoprotein protein IMP4
MC: Mpp10,U3 small nucleolar RNA-associated protein MPP10
P1: Pre-rRNA-processing protein PNO1
R1: RNA 3'-terminal phosphate cyclase-like protein
R2: rRNA biogenesis protein RRP5
S1: Sof1
SA: 18S ribosomal RNA
SC: 40S ribosomal protein S1-A
SF: 40S ribosomal protein S4-A
SG: 40S ribosomal protein S5
SH: 40S ribosomal protein S6-A
SI: 40S ribosomal protein S7-A
SJ: 40S ribosomal protein S8-A
SK: 40S ribosomal protein S9-A
SM: 40S ribosomal protein S11-A
SN: 40S ribosomal protein S12
SO: 40S ribosomal protein S13
SP: 40S ribosomal protein S14-A
SR: 40S ribosomal protein S16-A
SX: 40S ribosomal protein S22-A
SY: 40S ribosomal protein S23-A
SZ: 40S ribosomal protein S24-A
Sc: 40S ribosomal protein S27-A
Sd: 40S ribosomal protein S28-A
Sf: 40S ribosomal protein S30-A
Sg: Ubiquitin-40S ribosomal protein S31
U1: Utp7
U2: Utp11
U3: Utp20
U4: rRNA-processing protein FCF1
U5: Ribosome biogenesis protein UTP30
UA: Helical domain protein
UB: Helical domain protein
UC: Unassigned helices


Theoretical massNumber of molelcules
Total (without water)4,111,92264
Polyers4,111,92264
Non-polymers00
Water0
#1


  • idetical with deposited unit
  • defined by author
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1

-
Components

+
RNA chain , 3 types, 3 molecules 3A5ASA

#1: RNA chainU3 RNA


Mass: 106503.258 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
#7: RNA chain5ETS RNA


Mass: 225543.094 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: GenBank: 1262303
#34: RNA chain18S ribosomal RNA


Mass: 583636.562 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: GenBank: 874346701

+
Polypeptide(L) , 24 types, 27 molecules 3B3C3G3HAAABACADAFAG...

#2: Polypeptide(L)rRNA 2'-O-methyltransferase fibrillarin / Histone-glutamine methyltransferase / U3 small nucleolar RNA-associated protein NOP1 / U3 snoRNA-associated protein NOP1


Mass: 34525.418 Da / Num. of mol.: 2
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P15646, EC: 2.1.1.-

Cellular component

Molecular function

Biological process

#6: Polypeptide(L)13 kDa ribonucleoprotein-associated protein / Small nuclear ribonucleoprotein-associated protein 1


Mass: 13582.855 Da / Num. of mol.: 2
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P39990

Cellular component

Molecular function

Biological process

#8: Polypeptide(L)Utp4


Mass: 66059.172 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
#9: Polypeptide(L)Utp5


Mass: 54740.609 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
#10: Polypeptide(L)Utp8


Mass: 60697.750 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
#11: Polypeptide(L)Utp9


Mass: 48953.438 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
#13: Polypeptide(L)Utp15


Mass: 43676.871 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
#14: Polypeptide(L)Utp17


Mass: 76271.414 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
#16: Polypeptide(L)Periodic tryptophan protein 2 / U three protein 1 / U3 small nucleolar RNA-associated protein 1 / U3 snoRNA-associated protein 1


Mass: 104097.039 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P25635

Cellular component

Molecular function

Biological process

  • cell separation after cytokinesis (GO: 0000920)
  • endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000480)
  • endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000447)
  • endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000472)
  • establishment of cell polarity (GO: 0030010)
  • maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000462)
  • regulation of stomatal movement (GO: 0010119)
  • response to sucrose (GO: 0009744)
  • ribosomal small subunit assembly (GO: 0000028)
  • rRNA methylation (GO: 0031167)
#23: Polypeptide(L)Ribosomal RNA small subunit methyltransferase NEP1 / 18S rRNA (pseudouridine(1189)-N1)-methyltransferase / 18S rRNA Psi1189 methyltransferase / Essential for mitotic growth protein 1 / Nucleolar essential protein 1


Mass: 27936.461 Da / Num. of mol.: 2
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: Q06287, EC: 2.1.1.260

Cellular component

Molecular function

Biological process

  • endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000480)
  • endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000447)
  • endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000472)
  • ribosomal small subunit biogenesis (GO: 0042274)
  • rRNA base methylation (GO: 0070475)
  • rRNA methylation (GO: 0031167)
  • rRNA processing (GO: 0006364)
#24: Polypeptide(L)Essential nuclear protein 1


Mass: 55207.422 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P38333

Cellular component

Molecular function

Biological process

  • endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000447)
  • poly(A)+ mRNA export from nucleus (GO: 0016973)
  • rRNA processing (GO: 0006364)
#25: Polypeptide(L)Enp2


Mass: 60187.137 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
#26: Polypeptide(L)KRR1 small subunit processome component / KRR-R motif-containing protein 1 / Ribosomal RNA assembly protein KRR1


Mass: 37226.254 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P25586

Cellular component

Molecular function

Biological process

  • endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000447)
  • ribosomal small subunit biogenesis (GO: 0042274)
  • rRNA methylation (GO: 0031167)
  • rRNA processing (GO: 0006364)
#29: Polypeptide(L)Mpp10,U3 small nucleolar RNA-associated protein MPP10 / U3 snoRNA-associated protein MPP10 / M phase phosphoprotein 10


Mass: 54936.984 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P47083

Cellular component

Biological process

  • endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000480)
  • endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000447)
  • endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000472)
  • rRNA methylation (GO: 0031167)
#30: Polypeptide(L)Pre-rRNA-processing protein PNO1 / Partner of NOB1 / Ribosomal RNA-processing protein 20


Mass: 30380.623 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: Q99216

Cellular component

Molecular function

Biological process

  • endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000447)
  • endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000472)
  • proteasome assembly (GO: 0043248)
#31: Polypeptide(L)RNA 3'-terminal phosphate cyclase-like protein


Mass: 40220.559 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: Q08096

Cellular component

Molecular function

Biological process

  • endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000480)
  • endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000447)
  • endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000472)
  • rRNA methylation (GO: 0031167)
  • rRNA processing (GO: 0006364)
#32: Polypeptide(L)rRNA biogenesis protein RRP5 / Ribosomal RNA-processing protein 5 / U3 small nucleolar RNA-associated protein RRP5 / U3 snoRNA-associated protein RRP5


Mass: 193411.422 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: Q05022

Cellular component

Molecular function

Biological process

  • 90S preribosome assembly (GO: 0034463)
  • endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000480)
  • endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000447)
  • endonucleolytic cleavage in ITS1 upstream of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000464)
  • endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000472)
  • maturation of SSU-rRNA (GO: 0030490)
  • rRNA methylation (GO: 0031167)
  • rRNA processing (GO: 0006364)
#33: Polypeptide(L)Sof1


Mass: 41634.328 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
#53: Polypeptide(L)Ubiquitin-40S ribosomal protein S31


Mass: 17254.227 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P05759

Cellular component

Molecular function

Biological process

#54: Polypeptide(L)Utp7


Mass: 47166.211 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
#55: Polypeptide(L)Utp11


Mass: 21294.152 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
#56: Polypeptide(L)Utp20


Mass: 212188.828 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
#57: Polypeptide(L)rRNA-processing protein FCF1 / FAF1-copurifying factor 1


Mass: 21650.729 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: Q05498

Cellular component

Biological process

  • endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000480)
  • endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000447)
  • endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000472)
  • rRNA methylation (GO: 0031167)
#61: Polypeptide(L)Unassigned helices


Mass: 87930.383 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

+
Nucleolar protein ... , 2 types, 2 molecules 3D3E

#3: Polypeptide(L)Nucleolar protein 56 / Ribosome biosynthesis protein SIK1 / Suppressor of I kappa b protein 1


Mass: 56961.152 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: Q12460

Cellular component

Molecular function

Biological process

#4: Polypeptide(L)Nucleolar protein 58 / Nucleolar protein 5


Mass: 57060.344 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: Q12499

Cellular component

Molecular function

Biological process

  • endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000480)
  • endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000447)
  • endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000472)
  • rRNA 2'-O-methylation (GO: 0000451)
  • rRNA methylation (GO: 0031167)
  • rRNA modification (GO: 0000154)
  • rRNA processing (GO: 0006364)
  • snRNP protein import into nucleus (GO: 0006608)

+
Ribosomal RNA-processing protein ... , 2 types, 2 molecules 3FCA

#5: Polypeptide(L)Ribosomal RNA-processing protein 9


Mass: 65146.969 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: Q06506

Cellular component

Molecular function

Biological process

#21: Polypeptide(L)Ribosomal RNA-processing protein 7


Mass: 34526.441 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P25368

Cellular component

Biological process

+
U3 small nucleolar RNA-associated protein ... , 6 types, 6 molecules AEBBBCBDBECB

#12: Polypeptide(L)U3 small nucleolar RNA-associated protein 10,Utp10 / U3 snoRNA-associated protein 10 / U three protein 10 / U3 protein 10 required for transcription / t-UTP10


Mass: 173592.375 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P42945

Cellular component

Molecular function

Biological process

  • endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000480)
  • endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000447)
  • endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000472)
  • maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000462)
  • positive regulation of transcription from RNA polymerase I promoter (GO: 0045943)
  • rRNA methylation (GO: 0031167)
  • transcription, DNA-templated (GO: 0006351)
#17: Polypeptide(L)U3 small nucleolar RNA-associated protein 12 / U3 snoRNA-associated protein 12 / DOM34-interacting protein 2 / U three protein 12


Mass: 106481.133 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: Q12220

Cellular component

Molecular function

Biological process

  • endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000480)
  • endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000447)
  • endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000472)
  • maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000462)
  • rRNA methylation (GO: 0031167)
#18: Polypeptide(L)U3 small nucleolar RNA-associated protein 13 / U3 snoRNA-associated protein 13 / U three protein 13


Mass: 91132.562 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: Q05946

Cellular component

Molecular function

Biological process

  • endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000480)
  • endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000447)
  • endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000472)
  • maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000462)
  • rRNA methylation (GO: 0031167)
#19: Polypeptide(L)U3 small nucleolar RNA-associated protein 18 / U3 snoRNA-associated protein 18 / U three protein 18


Mass: 66494.250 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P40362

Cellular component

Biological process

  • endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000480)
  • endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000447)
  • endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000472)
  • rRNA methylation (GO: 0031167)
#20: Polypeptide(L)U3 small nucleolar RNA-associated protein 21 / U3 snoRNA-associated protein 21 / U three protein 21


Mass: 104927.844 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: Q06078

Cellular component

Biological process

#22: Polypeptide(L)U3 small nucleolar RNA-associated protein 22 / U3 snoRNA-associated protein 22 / U three protein 22


Mass: 140660.141 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P53254

Cellular component

Molecular function

Biological process

+
Ribosome biogenesis protein ... , 2 types, 2 molecules B1U5

#15: Polypeptide(L)Ribosome biogenesis protein BMS1


Mass: 135792.281 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: Q08965

Cellular component

Molecular function

Biological process

  • endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000480)
  • endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000472)
  • rRNA methylation (GO: 0031167)
#58: Polypeptide(L)Ribosome biogenesis protein UTP30 / U3 snoRNP-associated protein UTP30


Mass: 31668.939 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P36144

Cellular component

Molecular function

Biological process

  • maturation of LSU-rRNA (GO: 0000470)
  • maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000462)
  • ribosomal small subunit biogenesis (GO: 0042274)

+
U3 small nucleolar ribonucleoprotein protein ... , 2 types, 2 molecules MAMB

#27: Polypeptide(L)U3 small nucleolar ribonucleoprotein protein IMP3 / U3 snoRNP protein IMP3 / Interacting with MPP10 protein 3


Mass: 21928.529 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P32899

Cellular component

Molecular function

Biological process

#28: Polypeptide(L)U3 small nucleolar ribonucleoprotein protein IMP4 / U3 snoRNP protein IMP4 / Interacting with MPP10 protein 4


Mass: 33536.168 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P53941

Cellular component

Molecular function

Biological process

+
40S ribosomal protein ... , 18 types, 18 molecules SCSFSGSHSISJSKSMSNSO...

#35: Polypeptide(L)40S ribosomal protein S1-A / RP10A


Mass: 28798.467 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P33442

Cellular component

Molecular function

Biological process

  • cytoplasmic translation (GO: 0002181)
  • maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000462)
#36: Polypeptide(L)40S ribosomal protein S4-A / RP5 / S7 / YS6


Mass: 29469.330 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P0CX35

Cellular component

Molecular function

Biological process

#37: Polypeptide(L)40S ribosomal protein S5 / RP14 / S2 / YS8


Mass: 25072.600 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P26783

Cellular component

Molecular function

Biological process

#38: Polypeptide(L)40S ribosomal protein S6-A / RP9 / S10 / YS4


Mass: 27054.486 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P0CX37

Cellular component

Molecular function

Biological process

  • cytoplasmic translation (GO: 0002181)
  • maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000462)
  • rRNA methylation (GO: 0031167)
#39: Polypeptide(L)40S ribosomal protein S7-A / RP30 / RP40


Mass: 21658.209 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P26786

Cellular component

Molecular function

Biological process

#40: Polypeptide(L)40S ribosomal protein S8-A / RP19 / S14 / YS9


Mass: 22537.803 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P0CX39

Cellular component

Molecular function

Biological process

  • cytoplasmic translation (GO: 0002181)
  • maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000462)
#41: Polypeptide(L)40S ribosomal protein S9-A / RP21 / S13 / YP28 / YS11


Mass: 22487.893 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: O13516

Cellular component

Molecular function

Biological process

  • cytoplasmic translation (GO: 0002181)
  • maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000462)
  • positive regulation of translational fidelity (GO: 0045903)
  • rRNA methylation (GO: 0031167)
#42: Polypeptide(L)40S ribosomal protein S11-A / RP41 / S18 / YS12


Mass: 17785.934 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P0CX47

Cellular component

Molecular function

Biological process

#43: Polypeptide(L)40S ribosomal protein S12


Mass: 15488.631 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P48589

Cellular component

Molecular function

Biological process

#44: Polypeptide(L)40S ribosomal protein S13 / S27a / YS15


Mass: 17059.945 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P05756

Cellular component

Molecular function

Biological process

#45: Polypeptide(L)40S ribosomal protein S14-A / RP59A


Mass: 14562.655 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P06367

Cellular component

Molecular function

Biological process

#46: Polypeptide(L)40S ribosomal protein S16-A / RP61R


Mass: 15877.490 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P0CX51

Cellular component

Molecular function

Biological process

#47: Polypeptide(L)40S ribosomal protein S22-A / RP50 / S24 / YP58 / YS22


Mass: 14650.062 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P0C0W1

Cellular component

Molecular function

Biological process

#48: Polypeptide(L)40S ribosomal protein S23-A / RP37 / S28 / YS14


Mass: 16073.896 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P0CX29

Cellular component

Molecular function

Biological process

  • maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000462)
  • regulation of translational fidelity (GO: 0006450)
  • translation (GO: 0006412)
#49: Polypeptide(L)40S ribosomal protein S24-A / RP50


Mass: 15362.848 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P0CX31

Cellular component

Molecular function

Biological process

  • cytoplasmic translation (GO: 0002181)
  • maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (GO: 0000462)
#50: Polypeptide(L)40S ribosomal protein S27-A / RP61 / YS20


Mass: 8893.391 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P35997

Cellular component

Molecular function

Biological process

#51: Polypeptide(L)40S ribosomal protein S28-A / S33 / YS27


Mass: 7605.847 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: Q3E7X9

Cellular component

Molecular function

Biological process

#52: Polypeptide(L)40S ribosomal protein S30-A


Mass: 7137.541 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
References: UniProt: P0CX33

Cellular component

Molecular function

Biological process

+
Helical domain ... , 2 types, 2 molecules UAUB

#59: Polypeptide(L)Helical domain protein


Mass: 137462.422 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
#60: Polypeptide(L)Helical domain protein


Mass: 84015.695 Da / Num. of mol.: 1
Source: (natural) Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

+
Details

Sequence details(1) For chains AA, AB, AC, AD, AF, AG, E4, S1, U1, U2 and U3, The authors know the sequences, but they was unable to assign the sequences to the coordinates. The correct sequences are as follows. chain AA (UNP Q06679 1-776) MSSSLLSVLKEKSRSLKIRNKPVKMTSQERMIVHRCRFVDFTPATITSLAFSHKSNINKLTPSDLRLAIGRSNGNIEIWNPRNNWFQEMVIEGGKDRSIEGLCWSNVNGESLRLFSIGGSTVVTEWDLATGLPLRNYDCNSGVIWSISINDSQDKLSVGCDNGTVVLIDISGGPGVLEHDTILMRQEARVLTLAWKKDDFVIGGCSDGRIRIWSAQKNDENMGRLLHTMKVDKAKKESTLVWSVIYLPRTDQIASGDSTGSIKFWDFQFATLNQSFKAHDADVLCLTTDTDNNYVFSAGVDRKIFQFSQNTNKSQKNNRWVNSSNRLLHGNDIRAICAYQSKGADFLVSGGVEKTLVINSLTSFSNGNYRKMPTVEPYSKNVLVNKEQRLVVSWSESTVKIWTMGTDSSTEQNYKLVCKLTLKDDQNISTCSLSPDGQVLVVGRPSTTKVFHLQPVGNKLKVTKLDNDLLLRTSTKLVKFIDNSKIVICSCEDDVFIVDLESEEDEKPQEVELLEVTSTKSSIKVPYINRINHLEVDQNIAVISRGCGVVDILDLKARISKPLARLNNFITAVHINTSRKSVVVITADNKIYEFNMNLNSEAENEDSESVLTQWSKNNTDNLPKEWKTLKENCVGIFSDIENSSRLWFWGATWISRIDFDVDFPINKRRKQKKRTHEGLTITDESNFMNDEEDDEDDDIDMEISENLNVLLNQGNKIKSTDVQRNEESSGHFFFTDKYKPLLFVDLISSNELAIIERNPLTFHSKQKAFIQPKLVF chain AB (UNP Q04177 1-643) MDSPVLQSAYDPSGQYLCYVTVALDKQRVGVQPTQRATSSGVDTVWNENFLYLEDSKLKVTCLKWVNLASSDTVAIILGMNNGEIWLYSVLANEVTYKFTTGNSYEIKDIDLMGNQLWCIDSSDAFYQFDLLQFKLLQHFRINNCVQLNKLTIVPAGDSVAQLLVASHSISLIDIEEKKVVMTFPGHVSPVSTLQVITNEFFISGAEGDRFLNVYDIHSGMTKCVLVAESDIKELSHSGQADSIAVTTEDGSLEIFVDPLVSSSTKKRGNKSKKSSKKIQIVSKDGRKVPIYNAFINKDLLNVSWLQNATMPYFKNLQWREIPNEYTVEISLNWNNKNKSADRDLHGKDLASATNYVEGNARVTSGDNFKHVDDAIKSWERELTSLEQEQAKPPQANELLTETFGDKLESSTVARISGKKTNLKGSNLKTATTTGTVTVILSQALQSNDHSLLETVLNNRDERVIRDTIFRLKPALAVILLERLAERIARQTHRQGPLNVWVKWCLIIHGGYLVSIPNLMSTLSSLHSTLKRRSDLLPRLLALDARLDCTINKFKTLNYEAGDIHSSEPVVEEDEDDVEYNEELDDAGLIEDGEESYGSEEEEEGDSDNEEEQKHTSSKQDGRLETEQSDGEEEAGYSDVEME chain AC (UNP P53276 1-713) MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPTPKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGLMVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKIDTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDKVCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHCQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKTFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGNNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKTLTFLLTHPLFPLSRTRNLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQEMKKLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLENLTLYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI chain AD (UNP P38882 1-575) MGSSLDLVASFSHDSTRFAFQASVAQKNNVDIYPLNETKDYVVNSSLVSHIDYETNDMKVSDVIFFGWCSDLIDTQSSNIKRKLDEDEGTGESSEQRCENFFVNGFPDGRIVVYSSNGKDIVNIIKNKKEILGADTDESDIWILDSDKVVKKLQYNNSKPLKTFTLVDGKDDEIVHFQILHQNGTLLVCIITKQMVYIVDPSKRRPSTKYSFEISDAVACEFSSDGKYLLIANNEELIAYDLKEDSKLIQSWPVQVKTLKTLDDLIMALTTDGKINNYKIGEADKVCSIVVNEDLEIIDFTPINSKQQVLISWLNVNEPNFESISLKEIETQGYITINKNEKNNADEADQKKLEEKEEEAQPEVQHEKKETETKINKKVSKSDQVEIANILSSHLEANSTEILDDLMSGSWTEPEIKKFILTKINTVDHLSKIFLTISKSITQNPWNEENLLPLWLKWLLTLKSGELNSIKDKHTKKNCKHLKSALRSSEEILPVLLGIQGRLEMLRRQAKLREDLAQLSMQEGEDDEIEVIEHSNVISNPLQDQASPVEKLEPDSIVYANGESDEFVDASEYKD chain AF (UNP Q04305 1-513) MSTARPRIITSKAPLLPQQTTPEQRYWRQYTSAQLVKEHNSVTHISFNPQHPHDFAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYDSYNPRTILLSINASTHPTHVTKFHTQDNKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAAPHLVATGSYDGLIRLYDTRSSGSTPIYSLNHDQPVENVIAVSPTQIVSCGGNNFKVWDLTSNKKLYERGNFNKAVTCLDYVENFDSPMQSALIASSLDGHVKVFDPLDNFQVKFGWKFSGPVLSCAVSPSTAQGNRHLVAGLSSGLLAIRTKKKEKRSSDKENAPASFNKNAKSNNFQRMMRGSEYQGDQEHIIHNDKVRSQRRMRAFERNINQFKWSEALDNAFVPGMAKELTLTVLQELRKRGKVRVALYGRDESTLEPLLNWCLKGIEDVRSASIVADWVAVVLELYGNTLESSPVLQELMIDLKTKVRHEIHKSKEAQRIEGMLQLLTS chain AG (UNP Q02931 1-896) MTQSLGIEQYKLSVVSGGKPALNNLSSVTGNKNIARLSQDQRNYIIPFNNQIKVYSVETRQCVKTLKFANNSLLSGIFLQEEENNESIVKILLGDITVPQQEDAHLITVFTNNGHVIVLNYKGKLVESPKHFKISLADEKLANVFHSEGNYRILTTFKDPSQKAHNSLQSYRLYALTFDDAKKQFEVAHQAEWHNVILSNISSNGKLLAHMCKDVSTKDHEHKSISVVSLFDDSVNLSFPLGSILSSQTQSLSYNTRYVSSMAIDNMGQQLAVGFASGVISIVSLADLQIRLLKWHIDSVLSLSFSHDGSYLLSGGWEKVMSLWQLETNSQQFLPRLNGIIIDCQVLGPQGNYYSLILQMTENNSNSDYQFLLLNASDLTSKLSINGPLPVFNSTIKHIQQPISAMNTKNSNSITSLNHSKKKQSRKLIKSRRQDFTTNVEINPINKNLYFPHISAVQIFDFYKNEQVNYQYLTSGVNNSMGKVRFELNLQDPIITDLKFTKDGQWMITYEIEYPPNDLLSSKDLTHILKFWTKNDNETNWNLKTKVINPHGISVPITKILPSPRSVNNSQGCLTADNNGGLKFWSFDSHESNWCLKKISLPNFNHFSNSVSLAWSQDGSLIFHGFDDKLQILDFDTFKKFESLENTKTVSEFTLDSEIQTVKLINDTNLIVATRTTLNAINLLRGQVINSFDLYPFVNGVYKNGHMDRLITCDERTGNIALVINQQLTDLDGVPTINYKSRIIIFDSDLSTKLGNFTHHEYISWIGWNYDTDFIFLDIESTLGVVGTTVNTQLSDEVNNEGILDGLVSNTITTSASNSDIFAEQLHKLSSRGKKSDTRDKNTNDNDEDEEDIALEFINGEKKDKLVNMNSFTSMFDNIQNVQMDTFFDRVMKVLT chain E4 (UNP P48234 1-707) MVLKSTSANDVSVYQVSGTNVSRSLPDWIAKKRKRQLKNDLEYQNRVELIQDFEFSEASNKIKVSRDGQYCMATGTYKPQIHVYDFANLSLKFDRHTDAENVDFTILSDDWTKSVHLQNDRSIQFQNKGGLHYTTRIPKFGRSLVYNKVNCDLYVGASGNELYRLNLEKGRFLNPFKLDTEGVNHVSINEVNGLLAAGTETNVVEFWDPRSRSRVSKLYLENNIDNRPFQVTTTSFRNDGLTFACGTSNGYSYIYDLRTSEPSIIKDQGYGFDIKKIIWLDNVGTENKIVTCDKRIAKIWDRLDGKAYASMEPSVDINDIEHVPGTGMFFTANESIPMHTYYIPSLGPSPRWCSFLDSITEELEEKPSDTVYSNYRFITRDDVKKLNLTHLVGSRVLRAYMHGFFINTELYDKVSLIANPDAYKDEREREIRRRIEKERESRIRSSGAVQKPKIKVNKTLVDKLSQKRGDKVAGKVLTDDRFKEMFEDEEFQVDEDDYDFKQLNPVKSIKETEEGAAKRIRALTAAEESDEERIAMKDGRGHYDYEDEESDEEESDDETNQKSNKEELSEKDLRKMEKQKALIERRKKEKEQSERFMNEMKAGTSTSTQRDESAHVTFGEQVGELLEVENGKKSNESILRRNQRGEAELTFIPQRKSKKDGNYKSRRHDNSSDEEGIDENGNKKDNGRSKPRFENRRRASKNAFRGM chain S1 (UNP P33750 1-489) MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKLERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAKIHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQHVFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKLKERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKDMPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK chain U1 (UNP P40055 1-554) MGHKKNGHRRQIKERENQNKFERSTYTNNAKNNHTQTKDKKLRAGLKKIDEQYKKAVSSAAATDYLLPESNGYLEPENELEKTFKVQQSEIKSSVDVSTANKALDLSLKEFGPYHIKYAKNGTHLLITGRKGHVASMDWRKGQLRAELFLNETCHSATYLQNEQYFAVAQKKYTFIYDHEGTELHRLKQHIEARHLDFLPYHYLLVTAGETGWLKYHDVSTGQLVSELRTKAGPTMAMAQNPWNAVMHLGHSNGTVSLWSPSMPEPLVKLLSARGPVNSIAIDRSGYYMATTGADRSMKIWDIRNFKQLHSVESLPTPGTNVSISDTGLLALSRGPHVTLWKDALKLSGDSKPCFGSMGGNPHRNTPYMSHLFAGNKVENLGFVPFEDLLGVGHQTGITNLIVPGAGEANYDALELNPFETKKQRQEQEVRTLLNKLPADTITLDPNSIGSVDKRSSTIRLNAKDLAQTTMDANNKAKTNSDIPDVKPDVKGKNSGLRSFLRKKTQNVIDERKLRVQKQLDKEKNIRKRNHQIKQGLISEDHKDVIEEALSRFG chain U2 (UNP P34247 1-250) MAKLVHDVQKKQHRERSQLTSRSRYGFLEKHKDYVKRAQDFHRKQSTLKVLREKAKERNPDEYYHAMHSRKTDAKGLLISSRHGDEEDESLSMDQVKLLKTQDSNYVRTLRQIELKKLEKGAKQLMFKSSGNHTIFVDSREKMNEFTPEKFFNTTSEMVNRSENRLTKDQLAQDISNNRNASSIMPKESLDKKKLKKFKQVKQHLQRETQLKQVQQRMDAQRELLKKGSKKKIVDSSGKISFKWKKQRKR chain U3 (UNP P35194 1-2493) MAKQRQTTKSSKRYRYSSFKARIDDLKIEPARNLEKRVHDYVESSHFLASFDQWKEINLSAKFTEFAAEIEHDVQTLPQILYHDKKIFNSLVSFINFHDEFSLQPLLDLLAQFCHDLGPDFLKFYEEAIKTLINLLDAAIEFESSNVFEWGFNCLAYIFKYLSKFLVKKLVLTCDLLIPLLSHSKEYLSRFSAEALSFLVRKCPVSNLREFVRSVFEKLEGDDEQTNLYEGLLILFTESMTSTQETLHSKAKAIMSVLLHEALTKSSPERSVSLLSDIWMNISKYASIESLLPVYEVMYQDFNDSLDATNIDRILKVLTTIVFSESGRKIPDWNKITILIERIMSQSENCASLSQDKVAFLFALFIRNSDVKTLTLFHQKLFNYALTNISDCFLEFFQFALRLSYERVFSFNGLKFLQLFLKKNWQSQGKKIALFFLEVDDKPELQKVREVNFPEEFILSIRDFFVTAEINDSNDLFEIYWRAIIFKYSKLQNTEIIIPLLERIFSTFASPDNFTKDMVGTLLKIYRKEDDASGNNLLKTILDNYENYKESLNFLRGWNKLVSNLHPSESLKGLMSHYPSLLLSLTDNFMLPDGKIRYETLELMKTLMILQGMQVPDLLSSCMVIEEIPLTLQNARDLTIRIKNVGAEFGKTKTDKLVSSFFLKYLFGLLTVRFSPVWTGVFDTLPNVYTKDEALVWKLVLSFIKLPDENQNLDYYQPLLEDGANKVLWDSSVVRLRDTIDTFSHIWSKYSTQNTSIISTTIERRGNTTYPILIRNQALKVMLSIPQVAENHFVDIAPFVYNDFKTYKDEEDMENERVITGSWTEVDRNVFLKTLSKFKNIKNVYSATELHDHLMVLLGSRNTDVQKLALDALLAYKNPTLNKYRDNLKNLLDDTLFKDEITTFLTENGSQSIKAEDEKVVMPYVLRIFFGRAQVPPTSGQKRSRKIAVISVLPNFKKPYINDFLSLASERLDYNYFFGNSHQINSSKATLKTIRRMTGFVNIVNSTLSVLRTNFPLHTNSVLQPLIYSIAMAYYVLDTESTEEVHLRKMASNLRQQGLKCLSSVFEFVGNTFDWSTSMEDIYAVVVKPRISHFSDENLQQPSSLLRLFLYWAHNPSLYQFLYYDEFATATALMDTISNQHVKEAVIGPIIEAADSIIRNPVNDDHYVDLVTLICTSCLKILPSLYVKLSDSNSISTFLNLLVSITEMGFIQDDHVRSRLISSLISILKGKLKKLQENDTQKILKILKLIVFNYNCSWSDIEELYTTISSLFKTFDERNLRVSLTELFIELGRKVPELESISKLVADLNSYSSSRMHEYDFPRILSTFKGLIEDGYKSYSELEWLPLLFTFLHFINNKEELALRTNASHAIMKFIDFINEKPNLNEASKSISMLKDILLPNIRIGLRDSLEEVQSEYVSVLSYMVKNTKYFTDFEDMAILLYNGDEEADFFTNVNHIQLHRRQRAIKRLGEHAHQLKDNSISHYLIPMIEHYVFSDDERYRNIGNETQIAIGGLAQHMSWNQYKALLRRYISMLKTKPNQMKQAVQLIVQLSVPLRETLRIVRDGAESKLTLSKFPSNLDEPSNFIKQELYPTLSKILGTRDDETIIERMPIAEALVNIVLGLTNDDITNFLPSILTNICQVLRSKSEELRDAVRVTLGKISIILGAEYLVFVIKELMATLKRGSQIHVLSYTVHYILKSMHGVLKHSDLDTSSSMIVKIIMENIFGFAGEEKDSENYHTKVKEIKSNKSYDAGEILASNISLTEFGTLLSPVKALLMVRINLRNQNKLSELLRRYLLGLNHNSDSESESILKFCHQLFQESEMSNSPQIPKKKVKDQVDEKEDFFLVNLESKSYTINSNSLLLNSTLQKFALDLLRNVITRHRSFLTVSHLEGFIPFLRDSLLSENEGVVISTLRILITLIRLDFSDESSEIFKNCARKVLNIIKVSPSTSSELCQMGLKFLSAFIRHTDSTLKDTALSYVLGRVLPDLNEPSRQGLAFNFLKALVSKHIMLPELYDIADTTREIMVTNHSKEIRDVSRSVYYQFLMEYDQSKGRLEKQFKFMVDNLQYPTESGRQSVMELINLIITKANPALLSKLSSSFFLALVNVSFNDDAPRCREMASVLISTMLPKLENKDLEIVEKYIAAWLKQVDNASFLNLGLRTYKVYLKSIGFEHTIELDELAIKRIRYILSDTSVGSEHQWDLVYSALNTFSSYMEATESVYKHGFKDIWDGIITCLLYPHSWVRQSAANLVHQLIANKDKLEISLTNLEIQTIATRILHQLGAPSIPENLANVSIKTLVNISILWKEQRTPFIMDVSKQTGEDLKYTTAIDYMVTRIGGIIRSDEHRMDSFMSKKACIQLLALLVQVLDEDEVIAEGEKILLPLYGYLETYYSRAVDEEQEELRTLSNECLKILEDKLQVSDFTKIYTAVKQTVLERRKERRSKRAILAVNAPQISADKKLRKHARSREKRKHEKDENGYYQRRNKRKRA (2) For chains AE and MC Authors know the sequence and partially assigned the sequence (AE 1-808, MC 429-593) to the coordinates. The correct sequences are as follows. chain AE (UNP P42945 1-1769) MSSLSDQLAQVASNNATVALDRKRRQKLHSASLIYNSKTAATQDYDFIFENASKALEELSQIEPKFAIFSRTLFSESSISLDRNVQTKEEIKDLDNAINAYLLLASSKWYLAPTLHATEWLVRRFQIHVKNTEMLLLSTLNYYQTPVFKRILSIIKLPPLFNCLSNFVRSEKPPTALTMIKLFNDMDFLKLYTSYLDQCIKHNATYTNQLLFTTCCFINVVAFNSNNDEKLNQLVPILLEISAKLLASKSKDCQIAAHTILVVFATALPLKKTIILAAMETILSNLDAKEAKHSALLTICKLFQTLKGQGNVDQLPSKIFKLFDSKFDTVSILTFLDKEDKPVCDKFITSYTRSIARYDRSKLNIILSLLKKIRLERYEVRLIITDLIYLSEILEDKSQLVELFEYFISINEDLVLKCLKSLGLTGELFEIRLTTSLFTNADVNTDIVKQLSDPVETTKKDTASFQTFLDKHSELINTTNVSMLTETGERYKKVLSLFTEAIGKGYKASSFLTSFFTTLESRITFLLRVTISPAAPTALKLISLNNIAKYINSIEKEVNIFTLVPCLICALRDASIKVRTGVKKILSLIAKRPSTKHYFLSDKLYGENVTIPMLNPKDSEAWLSGFLNEYVTENYDISRILTPKRNEKVFLMFWANQALLIPSPYAKTVLLDNLNKSPTYASSYSSLFEEFISHYLENRSSWEKSCIANKTNFEHFERSLVNLVSPKEKQSFMIDFVLSALNSDYEQLANIAAERLISIFASLNNAQKLKIVQNIVDSSSNVESSYDTVGVLQSLPLDSDIFVSILNQNSISNEMDQTDFSKRRRRRSSTSKNAFLKEEVSQLAELHLRKLTIILEALDKVRNVGSEKLLFTLLSLLSDLETLDQDGGLPVLYAQETLISCTLNTITYLKEHGCTELTNVRADILVSAIRNSASPQVQNKLLLVIGSLATLSSEVILHSVMPIFTFMGAHSIRQDDEFTTKVVERTILTVVPALIKNSKGNEKEEMEFLLLSFTTALQHVPRHRRVKLFSTLIKTLDPVKALGSFLFLIAQQYSSALVNFKIGEARILIEFIKALLVDLHVNEELSGLNDLLDIIKLLTSSKSSSEKKKSLESRVLFSNGVLNFSESEFLTFMNNTFEFINKITEETDQDYYDVRRNLRLKVYSVLLDETSDKKLIRNIREEFGTLLEGVLFFINSVELTFSCITSQENEEASDSETSLSDHTTEIKEILFKVLGNVLQILPVDEFVNAVLPLLSTSTNEDIRYHLTLVIGSKFELEGSEAIPIVNNVMKVLLDRMPLESKSVVISQVILNTMTALVSKYGKKLEGSILTQALTLATEKVSSDMTEVKISSLALITNCVQVLGVKSIAFYPKIVPPSIKLFDASLADSSNPLKEQLQVAILLLFAGLIKRIPSFLMSNILDVLHVIYFSREVDSSIRLSVISLIIENIDLKEVLKVLFRIWSTEIATSNDTVAVSLFLSTLESTVENIDKKSATSQSPIFFKLLLSLFEFRSISSFDNNTISRIEASVHEISNSYVLKMNDKVFRPLFVILVRWAFDGEGVTNAGITETERLLAFFKFFNKLQENLRGIITSYFTYLLEPVDMLLKRFISKDMENVNLRRLVINSLTSSLKFDRDEYWKSTSRFELISVSLVNQLSNIENSIGKYLVKAIGALASNNSGVDEHNQILNKLIVEHMKASCSSNEKLWAIRAMKLIYSKIGESWLVLLPQLVPVIAELLEDDDEEIEREVRTGLVKVVENVLGEPFDRYLD chain MC (UNP P47083 1-593) MSELFGVLKSNAGRIILKDPSATSKDVKAYIDSVINTCKNGSITKKAELDEITVDGLDANQVWWQVKLVLDSIDGDLIQGIQELKDVVTPSHNLSDGSTLNSSSGEESELEEAESVFKEKQMLSADVSEIEEQSNDSLSENDEEPSMDDEKTSAEAAREEFAEEKRISSGQDERHSSPDPYGINDKFFDLEKFNRDTLAAEDSNEASEGSEDEDIDYFQDMPSDDEEEEAIYYEDFFDKPTKEPVKKHSDVKDPKEDEELDEEEHDSAMDKVKLDLFADEEDEPNAEGVGEASDKNLSSFEKQQIEIRKQIEQLENEAVAEKKWSLKGEVKAKDRPEDALLTEELEFDRTAKPVPVITSEVTESLEDMIRRRIQDSNFDDLQRRTLLDITRKSQRPQFELSDVKSSKSLAEIYEDDYTRAEDESALSEELQKAHSEISELYANLVYKLDVLSSVHFVPKPASTSLEIRVETPTISMEDAQPLYMSNASSLAPQEIYNVGKAEKDGEIRLKNGVAMSKEELTREDKNRLRRALKRKRSKANLPNVNKRSKRNDVVDTLSKAKNITVINQKGEKKDVSGKTKKSRSGPDSTNIKL (3) For chains UA, UB and UC The authors don't know the sequence.

-
Experimental details

-
Experiment

ExperimentMethod: ELECTRON MICROSCOPY
EM experimentAggregation state: PARTICLE / Reconstruction method: SINGLE PARTICLE

-
Sample preparation

ComponentName: 90S small subunit pre-ribosome (Dhr1-depleted, Enp1-TAP)
Type: COMPLEX
Entity ID: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61
Source: NATURAL
Source (natural)Organism: Saccharomyces cerevisiae
Buffer solutionpH: 8
Buffer component
IDConc.UnitsNameFormulaBuffer ID
1100mMpotassium acetateCH3COOK1
220mMHEPES-KHEPES-K1
SpecimenDetails: OD280=2 / Embedding applied: NO / Shadowing applied: NO / Staining applied: NO / Vitrification applied: YES
Specimen supportGrid material: COPPER / Grid type: Quantifoil R1.2/1.3
VitrificationInstrument: FEI VITROBOT MARK IV / Cryogen name: ETHANE / Humidity: 100 % / Chamber temperature: 277.15 kelvins

-
Electron microscopy imaging

Experimental equipment
Model: Titan Krios / Image courtesy: FEI Company
MicroscopyMicroscope model: FEI TITAN KRIOS
Electron gunElectron source: FIELD EMISSION GUN / Accelerating voltage: 300 kV / Illumination mode: FLOOD BEAM
Electron lensMode: BRIGHT FIELD / Nominal magnification: 45000 / Calibrated magnification: 79545 / Nominal defocus max: 4000 nm / Nominal defocus min: 2000 nm / Cs: 2.7 mm
Specimen holderCryogen: NITROGEN / Specimen holder model: FEI TITAN KRIOS AUTOGRID HOLDER
Image recordingAverage exposure time: 1.6 sec. / Electron dose: 40 e/Å2 / Film or detector model: OTHER / Number of grids imaged: 1 / Number of real images: 2055
Image scansDimension width: 4000 / Dimension height: 4000

-
Processing

EM software
IDNameVersionCategoryImaging IDImage processing ID
2Serial EMIMAGE ACQUISITION1
4CTFFIND4CTF CORRECTION1
10Relion1.4INITIAL EULER ASSIGNMENT1
11Relion1.4FINAL EULER ASSIGNMENT1
12Relion1.4CLASSIFICATION1
13Relion1.4RECONSTRUCTION1
Image processingDetails: detector is Falcon III
CTF correctionType: PHASE FLIPPING ONLY
Particle selectionNumber of particles selected: 420755
SymmetryPoint symmetry: C1
3D reconstructionResolution: 8.7 Å / Resolution method: FSC 0.143 CUT-OFF / Number of particles: 30995 / Algorithm: BACK PROJECTION / Number of class averages: 1 / Symmetry type: POINT

+
About Yorodumi

-
News

-
Oct 4, 2017. Three pioneers of this field were awarded Nobel Prize in Chemistry 2017

Three pioneers of this field were awarded Nobel Prize in Chemistry 2017

  • Jacques Dubochet (University of Lausanne, Switzerland) is a pioneer of ice-embedding method of EM specimen (as known as cryo-EM), Most of 3DEM structures in EMDB and PDB are obtained using his method.
  • Joachim Frank (Columbia University, New York, USA) is a pioneer of single particle reconstruction, which is the most used reconstruction method for 3DEM structures in EMDB and EM entries in PDB. And also, he is a develper of Spider, which is one of the most famous software in this field, and is used for some EM Navigor data (e.g. map projection/slice images).
  • Richard Henderson (MRC Laboratory of Molecular Biology, Cambridge, UK) was determined the first biomolecule structure by EM. The first EM entry in PDB, PDB-1brd is determinedby him.

External links: The 2017 Nobel Prize in Chemistry - Press Release

-
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary. This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated. See below links for details.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software). Now, EM Navigator and Yorodumi are based on the updated data.

External links: wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

+
Jun 16, 2017. Omokage search with filter

Omokage search with filter

  • Result of Omokage search can be filtered by keywords and the database types

Related info.: Omokage search

+
Sep 15, 2016. EM Navigator & Yorodumi renewed

EM Navigator & Yorodumi renewed

  • New versions of EM Navigator and Yorodumi started

Related info.: Changes in new EM Navigator and Yorodumi / EM Navigator (legacy version) / Yorodumi (legacy version)

+
Aug 31, 2016. New EM Navigator & Yorodumi

New EM Navigator & Yorodumi

  • In 15th Sep 2016, the development versions of EM Navigator and Yorodumi will replace the official versions.
  • Current version will continue as 'legacy version' for some time.

Related info.: Changes in new EM Navigator and Yorodumi / EM Navigator / Yorodumi / EM Navigator (legacy version) / Yorodumi (legacy version)

Read more

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • All the functionalities will be ported from the levgacy version.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.

Related info.: Yorodumi (legacy version) / EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Yorodumi Papers / Jmol/JSmol / Changes in new EM Navigator and Yorodumi

Read more