[English] 日本語
Yorodumi
- PDB-2nn6: Structure of the human RNA exosome composed of Rrp41, Rrp45, Rrp4... -

+
Open data


ID or keywords:

Loading...

-
Basic information

Entry
Database: PDB / ID: 2nn6
TitleStructure of the human RNA exosome composed of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, and Rrp40
Components
  • (Exosome complex exonuclease ...) x 6
  • 3'-5' exoribonuclease CSL4 homolog
  • Exosome component 6
  • Polymyositis/scleroderma autoantigen 1
KeywordsHYDROLASE/TRANSFERASE / RNA / exosome / PM/Scl / exoribonuclease / phosphorolytic / ribonuclease / HYDROLASE-TRANSFERASE COMPLEX
Function / homology
Function and homology information


DNA deamination / nucleolar exosome (RNase complex) / CUT catabolic process / U1 snRNA 3'-end processing / U5 snRNA 3'-end processing / TRAMP-dependent tRNA surveillance pathway / exosome (RNase complex) / cytoplasmic exosome (RNase complex) / mRNA decay by 3' to 5' exoribonuclease / U4 snRNA 3'-end processing ...DNA deamination / nucleolar exosome (RNase complex) / CUT catabolic process / U1 snRNA 3'-end processing / U5 snRNA 3'-end processing / TRAMP-dependent tRNA surveillance pathway / exosome (RNase complex) / cytoplasmic exosome (RNase complex) / mRNA decay by 3' to 5' exoribonuclease / U4 snRNA 3'-end processing / nuclear polyadenylation-dependent rRNA catabolic process / poly(A)-dependent snoRNA 3'-end processing / nuclear exosome (RNase complex) / Tristetraprolin (TTP, ZFP36) binds and destabilizes mRNA / exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) / ATF4 activates genes in response to endoplasmic reticulum stress / Butyrate Response Factor 1 (BRF1) binds and destabilizes mRNA / histone mRNA catabolic process / positive regulation of isotype switching / nuclear mRNA surveillance / rRNA catabolic process / Nuclear RNA decay / 7S RNA binding / isotype switching / mRNA 3'-UTR AU-rich region binding / RNA catabolic process / KSRP (KHSRP) binds and destabilizes mRNA / maturation of 5.8S rRNA / nuclear chromosome / mRNA catabolic process / nuclear-transcribed mRNA catabolic process / RNA processing / Major pathway of rRNA processing in the nucleolus and cytosol / euchromatin / fibrillar center / rRNA processing / chromosome / positive regulation of cell growth / 3'-5'-RNA exonuclease activity / defense response to virus / RNA polymerase II-specific DNA-binding transcription factor binding / immune response / nucleolus / positive regulation of transcription by RNA polymerase II / DNA binding / RNA binding / extracellular exosome / nucleoplasm / identical protein binding / nucleus / cytoplasm / cytosol
Similarity search - Function
Exosome complex component Rrp43 / : / Mammalian exosome complex component RRP40, N-terminal / Exosome complex component RRP45 / Rrp40, S1 domain / : / Exosome complex component RRP40, S1 domain / Exosome complex component CSL4, C-terminal / Exosome complex component, N-terminal domain / Exosome complex component Csl4 ...Exosome complex component Rrp43 / : / Mammalian exosome complex component RRP40, N-terminal / Exosome complex component RRP45 / Rrp40, S1 domain / : / Exosome complex component RRP40, S1 domain / Exosome complex component CSL4, C-terminal / Exosome complex component, N-terminal domain / Exosome complex component Csl4 / Exosome component EXOSC1/CSL4 / Exosome complex exonuclease RRP4 N-terminal region / RRP4, S1 domain / : / KH domain / Exosome complex RNA-binding protein 1/RRP40/RRP4 / GHMP Kinase, N-terminal domain / : / : / K Homology domain, type 1 / Exoribonuclease, phosphorolytic domain 2 / 3' exoribonuclease family, domain 2 / Exoribonuclease, phosphorolytic domain 1 / PNPase/RNase PH domain superfamily / Exoribonuclease, PH domain 2 superfamily / 3' exoribonuclease family, domain 1 / K Homology domain, type 1 / Ribosomal Protein S8; Chain: A, domain 1 / RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain / K Homology domain, type 1 superfamily / Ribosomal Protein S5; domain 2 / Nucleic acid-binding proteins / Ribosomal protein S1-like RNA-binding domain / S1 domain / OB fold (Dihydrolipoamide Acetyltransferase, E2P) / Ribosomal protein S5 domain 2-type fold / Nucleic acid-binding, OB-fold / Beta Barrel / 2-Layer Sandwich / Mainly Beta / Alpha Beta
Similarity search - Domain/homology
Exosome complex component RRP45 / Exosome complex component RRP4 / Exosome complex component RRP42 / Exosome complex component MTR3 / Exosome complex component RRP45 / Exosome complex component RRP43 / Exosome complex component RRP41 / Exosome complex component RRP46 / Exosome complex component RRP40 / Exosome complex component CSL4
Similarity search - Component
Biological speciesHomo sapiens (human)
MethodX-RAY DIFFRACTION / SYNCHROTRON / MIRAS / Resolution: 3.35 Å
AuthorsLima, C.D.
CitationJournal: Cell(Cambridge,Mass.) / Year: 2006
Title: Reconstitution, activities, and structure of the eukaryotic RNA exosome.
Authors: Liu, Q. / Greimann, J.C. / Lima, C.D.
History
DepositionOct 23, 2006Deposition site: RCSB / Processing site: RCSB
Revision 1.0Dec 26, 2006Provider: repository / Type: Initial release
Revision 1.1May 1, 2008Group: Version format compliance
Revision 1.2Jul 13, 2011Group: Version format compliance
Revision 1.3Dec 27, 2023Group: Data collection / Database references
Category: chem_comp_atom / chem_comp_bond ...chem_comp_atom / chem_comp_bond / database_2 / struct_ref_seq_dif
Item: _database_2.pdbx_DOI / _database_2.pdbx_database_accession / _struct_ref_seq_dif.details
Remark 999 SEQUENCE IN THE C-TERMINAL REGION OF CHAIN "A", 303-456, ONLY THIRTY EIGHT RESIDUES WERE VISIBLE ... SEQUENCE IN THE C-TERMINAL REGION OF CHAIN "A", 303-456, ONLY THIRTY EIGHT RESIDUES WERE VISIBLE IN ELECTRON DENSITY. THE SEQUENCE NUMBERING 412-449 OF THESE 38 RESIDUES IN CHAIN A IS RANDOM, AND THESE RESIDUES ARE ASSIGNED AS "UNK" (UNKNOWN AMINO ACIDS). THE SEQUENCE ALIGNMENT IS UNKNOWN IN THIS REGION. THE SEQUENCE IN THIS DISORDERED REGION (RESIDUES 303-456) IS: IDTSDVEEKAEEIIAEAEPPSEVVSTPVLWTPGTAQIGEGVENSWGD LEDSEKEDDEGGGDQAIILDGIKMDTGVEVSDIGSQELGFHHVGQTG LEFLTSDAPIILSDSEEEEMIILEPDKNPKKIRTQTTSAKQEKAPSK KPVKRRKKKRAAN

-
Structure visualization

Structure viewerMolecule:
MolmilJmol/JSmol

Downloads & links

-
Assembly

Deposited unit
A: Polymyositis/scleroderma autoantigen 1
B: Exosome complex exonuclease RRP41
C: Exosome complex exonuclease RRP43
D: Exosome complex exonuclease RRP46
E: Exosome complex exonuclease RRP42
F: Exosome component 6
G: Exosome complex exonuclease RRP40
H: Exosome complex exonuclease RRP4
I: 3'-5' exoribonuclease CSL4 homolog


Theoretical massNumber of molelcules
Total (without water)272,6669
Polymers272,6669
Non-polymers00
Water00
1


  • Idetical with deposited unit
  • defined by author&software
TypeNameSymmetry operationNumber
identity operation1_555x,y,z1
Buried area26920 Å2
ΔGint-116 kcal/mol
Surface area98680 Å2
MethodPISA
Unit cell
Length a, b, c (Å)307.800, 307.800, 307.800
Angle α, β, γ (deg.)90.00, 90.00, 90.00
Int Tables number207
Space group name H-MP432

-
Components

-
Protein , 3 types, 3 molecules AFI

#1: Protein Polymyositis/scleroderma autoantigen 1 / Ribosomal RNA-processing protein 45 / Rrp45 / PM/Scl-75


Mass: 39405.801 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Strain: placental cDNA (Ambion, Inc) / Gene: PMSCL1 / Plasmid: pETDuet-1 (Novagen) / Production host: Escherichia coli (E. coli) / Strain (production host): BL21(DE3)CodonPlus-RIL / References: UniProt: Q86Y41, UniProt: Q06265*PLUS
#6: Protein Exosome component 6 / Mtr3


Mass: 28267.127 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Strain: placental cDNA (Ambion, Inc) / Gene: EXOSC6 / Plasmid: pRSFDuet-1 (Novagen) / Production host: Escherichia coli (E. coli) / Strain (production host): BL21(DE3)Star / References: UniProt: Q5RKV6
#9: Protein 3'-5' exoribonuclease CSL4 homolog / Exosome component 1


Mass: 23097.463 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Strain: placental cDNA (Ambion, Inc) / Gene: EXOSC1, CSL4 / Plasmid: pRSFDuet-1 (Novagen) / Production host: Escherichia coli (E. coli) / Strain (production host): BL21(DE3)CodonPlus-RIL
References: UniProt: Q9Y3B2, Hydrolases; Acting on ester bonds; Exoribonucleases producing 5'-phosphomonoesters

-
Exosome complex exonuclease ... , 6 types, 6 molecules BCDEGH

#2: Protein Exosome complex exonuclease RRP41 / Ribosomal RNA-processing protein 41 / Exosome component 4 / p12A


Mass: 26831.473 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Strain: placental cDNA (Ambion, Inc) / Gene: EXOSC4, RRP41, SKI6 / Plasmid: pETDuet-1 (Novagen) / Production host: Escherichia coli (E. coli) / Strain (production host): BL21(DE3)CodonPlus-RIL
References: UniProt: Q9NPD3, Hydrolases; Acting on ester bonds; Exoribonucleases producing 5'-phosphomonoesters
#3: Protein Exosome complex exonuclease RRP43 / Ribosomal RNA-processing protein 43 / Exosome component 8 / p9 / Opa-interacting protein 2 / OIP2


Mass: 30285.762 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Strain: placental cDNA (Ambion, Inc) / Gene: EXOSC8, OIP2, RRP43 / Plasmid: pSMT3 (Smt3 fusion) / Production host: Escherichia coli (E. coli) / Strain (production host): BL21(DE3)CodonPlus-RIL
References: UniProt: Q96B26, Hydrolases; Acting on ester bonds; Exoribonucleases producing 5'-phosphomonoesters
#4: Protein Exosome complex exonuclease RRP46 / Ribosomal RNA-processing protein 46 / Exosome component 5 / p12B / Chronic myelogenous leukemia ...Ribosomal RNA-processing protein 46 / Exosome component 5 / p12B / Chronic myelogenous leukemia tumor antigen 28


Mass: 25480.213 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Strain: placental cDNA (Ambion, Inc) / Gene: EXOSC5, CML28, RRP46 / Plasmid: pSMT3 (Smt3-fusion) / Production host: Escherichia coli (E. coli) / Strain (production host): BL21(DE3)CodonPlus-RIL
References: UniProt: Q9NQT4, Hydrolases; Acting on ester bonds; Exoribonucleases producing 5'-phosphomonoesters
#5: Protein Exosome complex exonuclease RRP42 / Ribosomal RNA-processing protein 42 / Exosome component 7 / p8


Mass: 33479.121 Da / Num. of mol.: 1 / Mutation: L274V
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Strain: placental cDNA (Ambion, Inc) / Gene: EXOSC7, KIAA0116, RRP42 / Plasmid: pRSFDuet-1 (Novagen) / Production host: Escherichia coli (E. coli) / Strain (production host): BL21(DE3)Star
References: UniProt: Q15024, Hydrolases; Acting on ester bonds; Exoribonucleases producing 5'-phosphomonoesters
#7: Protein Exosome complex exonuclease RRP40 / Ribosomal RNA-processing protein 40 / Exosome component 3 / p10


Mass: 31227.881 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Strain: placental cDNA (Ambion, Inc) / Gene: EXOSC3, RRP40 / Plasmid: pRSFDuet-1 (Novagen) / Production host: Escherichia coli (E. coli) / Strain (production host): BL21(DE3)CodonPlus-RIL
References: UniProt: Q9NQT5, Hydrolases; Acting on ester bonds; Exoribonucleases producing 5'-phosphomonoesters
#8: Protein Exosome complex exonuclease RRP4 / Ribosomal RNA-processing protein 4 / Exosome component 2


Mass: 34590.852 Da / Num. of mol.: 1
Source method: isolated from a genetically manipulated source
Source: (gene. exp.) Homo sapiens (human) / Strain: placental cDNA (Ambion, Inc) / Gene: EXOSC2, RRP4 / Plasmid: pRSFDuet-1 (Novagen) / Production host: Escherichia coli (E. coli) / Strain (production host): BL21(DE3)CodonPlus-RIL
References: UniProt: Q13868, Hydrolases; Acting on ester bonds; Exoribonucleases producing 5'-phosphomonoesters

-
Experimental details

-
Experiment

ExperimentMethod: X-RAY DIFFRACTION / Number of used crystals: 1

-
Sample preparation

CrystalDensity Matthews: 4.45 Å3/Da / Density % sol: 72.39 %
Crystal growTemperature: 291 K / Method: vapor diffusion, hanging drop / pH: 5.5
Details: 4.5-8% w/v PEG4000, 0.1M Sodium citrate, 1 mM TCEP, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K

-
Data collection

DiffractionMean temperature: 100 K
Diffraction sourceSource: SYNCHROTRON / Site: APS / Beamline: 24-ID-C / Wavelength: 0.9809 Å
DetectorType: ADSC QUANTUM 315 / Detector: CCD / Date: Jun 30, 2006
RadiationProtocol: SINGLE WAVELENGTH / Monochromatic (M) / Laue (L): M / Scattering type: x-ray
Radiation wavelengthWavelength: 0.9809 Å / Relative weight: 1
ReflectionResolution: 3.35→35 Å / Num. all: 69964 / Num. obs: 69964 / % possible obs: 97.8 % / Observed criterion σ(F): 0 / Observed criterion σ(I): 0 / Redundancy: 5.3 % / Biso Wilson estimate: 38.6 Å2 / Rmerge(I) obs: 0.08 / Net I/σ(I): 10.5
Reflection shellResolution: 3.35→3.47 Å / Redundancy: 2.9 % / Rmerge(I) obs: 0.43 / Mean I/σ(I) obs: 1.6 / Num. unique all: 6999 / % possible all: 95.5

-
Processing

Software
NameVersionClassification
CNS1.1refinement
ADSCQUANTUMdata collection
DENZOdata reduction
SCALEPACKdata scaling
MLPHAREphasing
RefinementMethod to determine structure: MIRAS / Resolution: 3.35→14.98 Å / Rfactor Rfree error: 0.006 / Data cutoff high absF: 59512279.13 / Data cutoff low absF: 0 / Isotropic thermal model: RESTRAINED / Cross valid method: THROUGHOUT / σ(F): 0 / Stereochemistry target values: Engh & Huber
Details: BULK SOLVENT MODEL USED CNS version 1.2 grid search used
RfactorNum. reflection% reflectionSelection details
Rfree0.344 3465 5 %RANDOM
Rwork0.291 ---
obs0.291 69115 97.7 %-
all-69115 --
Solvent computationSolvent model: FLAT MODEL / Bsol: 42.5031 Å2 / ksol: 0.26 e/Å3
Displacement parametersBiso mean: 119.4 Å2
Baniso -1Baniso -2Baniso -3
1-0 Å20 Å20 Å2
2--0 Å20 Å2
3---0 Å2
Refine analyze
FreeObs
Luzzati coordinate error0.74 Å0.63 Å
Luzzati d res low-6 Å
Luzzati sigma a1.35 Å0.98 Å
Refinement stepCycle: LAST / Resolution: 3.35→14.98 Å
ProteinNucleic acidLigandSolventTotal
Num. atoms16858 0 0 0 16858
Refine LS restraints
Refine-IDTypeDev idealDev ideal target
X-RAY DIFFRACTIONc_bond_d0.01
X-RAY DIFFRACTIONc_angle_deg1.7
X-RAY DIFFRACTIONc_dihedral_angle_d24.7
X-RAY DIFFRACTIONc_improper_angle_d1.1
X-RAY DIFFRACTIONc_mcbond_it3.042.5
X-RAY DIFFRACTIONc_mcangle_it5.263.5
X-RAY DIFFRACTIONc_scbond_it5.364.5
X-RAY DIFFRACTIONc_scangle_it8.25.5
LS refinement shellResolution: 3.35→3.47 Å / Rfactor Rfree error: 0.022 / Total num. of bins used: 10
RfactorNum. reflection% reflection
Rfree0.398 336 5.2 %
Rwork0.349 6167 -
obs--93.3 %
Xplor file
Refine-IDSerial noParam fileTopol file
X-RAY DIFFRACTION1protein_rep.paramprotein.top
X-RAY DIFFRACTION2dna-rna.paramdna-rna.top
X-RAY DIFFRACTION3water_rep.paramwater.top
X-RAY DIFFRACTION4ion.paramion.top

+
About Yorodumi

-
News

-
Feb 9, 2022. New format data for meta-information of EMDB entries

New format data for meta-information of EMDB entries

  • Version 3 of the EMDB header file is now the official format.
  • The previous official version 1.9 will be removed from the archive.

Related info.:EMDB header

External links:wwPDB to switch to version 3 of the EMDB data model

-
Aug 12, 2020. Covid-19 info

Covid-19 info

URL: https://pdbj.org/emnavi/covid19.php

New page: Covid-19 featured information page in EM Navigator.

Related info.:Covid-19 info / Mar 5, 2020. Novel coronavirus structure data

+
Mar 5, 2020. Novel coronavirus structure data

Novel coronavirus structure data

Related info.:Yorodumi Speices / Aug 12, 2020. Covid-19 info

External links:COVID-19 featured content - PDBj / Molecule of the Month (242):Coronavirus Proteases

+
Jan 31, 2019. EMDB accession codes are about to change! (news from PDBe EMDB page)

EMDB accession codes are about to change! (news from PDBe EMDB page)

  • The allocation of 4 digits for EMDB accession codes will soon come to an end. Whilst these codes will remain in use, new EMDB accession codes will include an additional digit and will expand incrementally as the available range of codes is exhausted. The current 4-digit format prefixed with “EMD-” (i.e. EMD-XXXX) will advance to a 5-digit format (i.e. EMD-XXXXX), and so on. It is currently estimated that the 4-digit codes will be depleted around Spring 2019, at which point the 5-digit format will come into force.
  • The EM Navigator/Yorodumi systems omit the EMD- prefix.

Related info.:Q: What is EMD? / ID/Accession-code notation in Yorodumi/EM Navigator

External links:EMDB Accession Codes are Changing Soon! / Contact to PDBj

+
Jul 12, 2017. Major update of PDB

Major update of PDB

  • wwPDB released updated PDB data conforming to the new PDBx/mmCIF dictionary.
  • This is a major update changing the version number from 4 to 5, and with Remediation, in which all the entries are updated.
  • In this update, many items about electron microscopy experimental information are reorganized (e.g. em_software).
  • Now, EM Navigator and Yorodumi are based on the updated data.

External links:wwPDB Remediation / Enriched Model Files Conforming to OneDep Data Standards Now Available in the PDB FTP Archive

-
Yorodumi

Thousand views of thousand structures

  • Yorodumi is a browser for structure data from EMDB, PDB, SASBDB, etc.
  • This page is also the successor to EM Navigator detail page, and also detail information page/front-end page for Omokage search.
  • The word "yorodu" (or yorozu) is an old Japanese word meaning "ten thousand". "mi" (miru) is to see.

Related info.:EMDB / PDB / SASBDB / Comparison of 3 databanks / Yorodumi Search / Aug 31, 2016. New EM Navigator & Yorodumi / Yorodumi Papers / Jmol/JSmol / Function and homology information / Changes in new EM Navigator and Yorodumi

Read more