| PDBID: | 9bz2 | | Status: | HPUB -- hold until publication | | Title: | Class 14 model for turnover condition of Bacillus subtilis ribonucleotide reductase complex | | Authors: | Xu, D., Thomas, W.C., Burnim, A.A., Ando, N. | | Deposition date: | 2024-05-24 |
|
| PDBID: | 9bxb | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HIV-1 LM/HS CLADE A/E CRF01 GP120 CORE IN COMPLEX WITH DL-III-14 | | Authors: | Niu, L., Tolbert, W.D., Pazgier, M. | | Deposition date: | 2024-05-22 |
|
| PDBID: | 9bjp | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 WT in complex with BLIP E73W | | Authors: | Lu, S., Rivera, P., Sankaran, B., Prasad, B.V.V., Palzkill, T.G. | | Deposition date: | 2024-04-25 |
|
| PDBID: | 9f35 | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of 14-3-3sigma in complex with B-Raf pS365 phosphopeptide | | Authors: | Wu, Q. | | Deposition date: | 2024-04-24 |
|
| PDBID: | 9f1j | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | First bromodomain of BRD4 in complex with ISOX-DUAL based degrader 14 | | Authors: | Balourdas, D.I., Edmonds, A.K., Marsh, G.P., Maple, H.J., Spencer, J., Knapp, S., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9exi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Coxsackievirus A9 bound with compound 14 (CL275) | | Authors: | Plavec, Z., Butcher, S.J., Mitchell, C., Buckner, C. | | Deposition date: | 2024-04-08 |
|
| PDBID: | 9bat | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of sterol 14 alpha-demethylase (CYP51) from deep-sea fish Coryphaenoides armatus (abyssal grenadier) in the ligand-free state | | Authors: | Hargrove, T.Y., Wawrzak, Z., Minasov, G., Lepesheva, G.I. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 9ew1 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, CRAF phosphopeptide (pS259) and compound 79 (1124379). | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew3 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide 12-mer (pS259) and compound 78 (1084378) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew4 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide 12mer (pS259) and compound 86 (1124384) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew7 | | Status: | HPUB -- hold until publication | | Title: | Binary structure of 14-3-3s and CRAF phosphopeptide (pS259) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) 12mer and compound 23 (1083848) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ew6 | | Status: | HPUB -- hold until publication | | Title: | Binary structure of 14-3-3s and BRAF phosphopeptide (pS365) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yue | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the kinesin-14 motor protein from Drosophila melanogaster | | Authors: | Wei, Y., Jobichen, C., Imasaki, T., Nitta, R., Wang, M.Y., Sivaraman, J., Endow, S.A. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9esz | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 14 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GPGSMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
>Entity 2
GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNVHHHHHH
|
|
| PDBID: | 8s42 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 80 (1124898) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8s2q | | Status: | HPUB -- hold until publication | | Title: | MSOX movie series dataset 2 (1.14 MGy) for as isolated BrJNiR (Cu containing nitrite reductase (NirK) from Bradyrhizobium japonicum USDA110) at pH 8. | | Authors: | Rose, S.L., Ferroni, F.M., Horrell, S., Brondino, C.D., Eady, R.R., Jaho, S., Hough, M.A., Owen, A.L., Antonyuk, S.V., Hasnain, S.S. | | Deposition date: | 2024-02-18 |
|
| PDBID: | 8vso | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3 sigma, BRAF phosphopeptide (pS365) and compound 78 (1124378) | | Authors: | Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8rs1 | | Status: | HPUB -- hold until publication | | Title: | CTX-M-14 measured via serial crystallography from a kapton HARE-chip (125 micron) | | Authors: | Bosman, R., Prester, A., von Soosten, L., Dibenedetto, S., Bartels, K., Sung, S., von Stetten, D., Mehrabi, P., Schulz, E.C. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8vsm | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3 sigma, ARAF phosphopeptide (pS214) and compound 78 (1124378) | | Authors: | Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8vsl | | Status: | HPUB -- hold until publication | | Title: | Binary structure of 14-3-3 sigma and ARAF phosphopeptide (pS214) | | Authors: | Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8vsn | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3 sigma, ARAF phosphopeptide (pS214) and compound 79 (1124379) | | Authors: | Vickery, H.R., Virta, J.M., Pennings, M., Konstantinidou, M., van den Oetelaar, M., Neitz, R.J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-01-24 |
|
| PDBID: | 8rky | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of the drug binding domain of AlbA in complex with the KMR-14-14 compound of the pyrrolobenzodiazepines class | | Authors: | Di Palma, M., Surani, Y.M., Rahman, K.M., Steiner, R.A. | | Deposition date: | 2024-01-01 |
|
| PDBID: | 8xke | | Status: | HPUB -- hold until publication | | Title: | The structure of HLA-A/14-3-D | | Authors: | Zhang, J.N., Yue, C., Liu, J., Sun, Z.Y. | | Deposition date: | 2023-12-23 |
|
| PDBID: | 8xi3 | | Status: | HOLD -- hold until a certain date | | Title: | Structure of mouse SCMC-14-3-3gama complex | | Authors: | Chi, P., Han, Z., Jiao, H., Li, J., Wang, X., Hu, H., Deng, D. | | Deposition date: | 2023-12-19 | | Release date: | 2024-12-19 |
|
