| PDBID: | 9fcq | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H122A mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHALEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 9fcg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Medicago truncatula 5''-ProFAR isomerase (HISN3) D57N mutant in complex with PrFAR | | Authors: | Witek, W., Imiolczyk, B., Ruszkowski, M. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fcs | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H122N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHNLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 9fcu | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H121A mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIAHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGSC
|
|
| PDBID: | 9fcf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Medicago truncatula 5''-ProFAR isomerase (HISN3) D57N mutant in complex with ProFAR | | Authors: | Witek, W., Imiolczyk, B., Ruszkowski, M. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fc3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fc4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-15 |
|
| PDBID: | 9fc5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zj6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8ziw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | enteropeptidase with E574A | | Authors: | Song, Q.Y., Ding, Z.Y., Huang, H.J. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zj0 | | Status: | HPUB -- hold until publication | | Title: | Terephthalate 1,2-cis-dihydrodioldehydrogenase/Decarboxylase in complex with 3-Hydroxybenzoate. | | Authors: | Kumar, K.A., Pahwa, D., Kumar, P. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zjb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Oomycete Nudix effectors display WY-Nudix conformations with mRNA decapping activity | | Authors: | Xing, W., Xing, W. | | Deposition date: | 2024-05-14 | | Release date: | 2025-05-14 |
|
| PDBID: | 8ziy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | trypsinogen-EP-E574A | | Authors: | Song, Q.Y., Ding, Z.Y., Huang, H.J. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8ziz | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | enteropeptidase with N619A | | Authors: | Song, Q.Y., Ding, Z.Y., Huang, H.J. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zj4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | trypsinogen-EP-N619A | | Authors: | Song, Q.Y., Ding, Z.Y., Huang, H.J. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zj3 | | Status: | HPUB -- hold until publication | | Title: | Terephthalate 1,2-cis-dihydrodioldehydrogenase/Decarboxylase in complex with 4-Hydroxybenzoate. | | Authors: | Kumar, K.A., Pahwa, D., Kumar, P. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zj5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Terephthalate 1,2-cis-dihydrodioldehydrogenase/Decarboxylase in complex with 3,4-Dihydroxybenzoate. | | Authors: | Kumar, K.A., Pahwa, D., Kumar, P. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zj8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zj9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Acinetobacter baumannii ModA with tungstate DTT | | Authors: | Wen, Y., Jiao, M. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zja | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zjf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of human integrin alpha-E beta-7 | | Authors: | Akasaka, H., Nureki, O., Kise, Y. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zj7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Terephthalate 1,2-cis-dihydrodioldehydrogenase/Decarboxylase in complex with 3,4-Dihydroxybenzoate and NAD. | | Authors: | Kumar, K.A., Pahwa, D., Kumar, P. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zjg | | Status: | PROC -- to be processed | | Title: | Cryo-EM structure of human CMKLR1-Gi complex bound to chemerin | | Authors: | Liu, A.J., Liu, Y.Z., Ye, R.D. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zjc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex | | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zit | | Status: | PROC -- to be processed | | Deposition date: | 2024-05-14 |
|
